Protein Information |
Information Type | Description |
---|---|
Protein name | 50S ribosomal protein L35 |
NCBI Accession ID | CP000027.1 |
Organism | Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) (Dehalococcoides ethenogenes (strain 195)) |
Left | 691477 |
Right | 691680 |
Strand | - |
Nucleotide Sequence | ATGCCTAAAATGAAAACCAGAAAGACTGCTGCAAAGCGCTTTCATGTAACCGGTACCGGCAAGATTATGCGCAGCAAGGGCATGAAGAGCCACCTGCGCCGTAATAAATCCGCCAGAGTACGCCGCCAGTTTGACGAAATGTCTCAGGTAGCTGGTGTGGACAGGGCTCGTATTCAAAAGTTAATTCCGTATGGTGTAAGCTAA |
Sequence | MPKMKTRKTAAKRFHVTGTGKIMRSKGMKSHLRRNKSARVRRQFDEMSQVAGVDRARIQKLIPYGVS |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00392. Profile Description: Ribosomal protein L35. This ribosomal protein is found in bacteria and organelles only. It is not closely related to any eukaryotic or archaeal ribosomal protein. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
Pubmed ID | 15637277 |
Domain | CDD:412354 |
Functional Category | Ribosomal_protein |
Uniprot ID | Q3Z8G4 |
ORF Length (Amino Acid) | 67 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 611123 | 611326 | - | NZ_CP006950.1 | Dehalococcoides mccartyi CG4 |
2 | 777443 | 777646 | + | NZ_CP018258.1 | Dehalogenimonas formicexedens |
3 | 822251 | 822451 | + | NC_013525.1 | Thermobaculum terrenum ATCC BAA-798 |
4 | 805547 | 805747 | - | NC_014314.1 | Dehalogenimonas lykanthroporepellens BL-DC-9 |
5 | 810442 | 810642 | + | NC_011959.1 | Thermomicrobium roseum DSM 5159 |
6 | 5590589 | 5590786 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
7 | 1830140 | 1830337 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
8 | 456857 | 457054 | + | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
9 | 1664628 | 1664825 | + | NC_002939.5 | Geobacter sulfurreducens PCA |
10 | 1888008 | 1888205 | - | NZ_CP009788.1 | Geobacter pickeringii |
11 | 4382611 | 4382808 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
12 | 2787634 | 2787801 | + | NZ_AP018437.1 | Pelolinea submarina |
13 | 2831063 | 2831260 | - | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
14 | 1782707 | 1782907 | - | NZ_AP022873.1 | Dissulfurispira thermophila |
15 | 2864109 | 2864303 | - | NZ_CP027793.1 | Rhodococcus hoagii |
16 | 4393319 | 4393522 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
17 | 2657873 | 2658067 | - | NZ_CP027433.1 | Gordonia iterans |
18 | 419701 | 419898 | + | NC_008576.1 | Magnetococcus marinus MC-1 |
19 | 1480201 | 1480398 | + | NC_013204.1 | Eggerthella lenta DSM 2243 |
20 | 1923989 | 1924186 | - | NZ_CP009302.1 | Berryella intestinalis |
21 | 1064635 | 1064832 | + | NZ_CP011402.1 | Denitrobacterium detoxificans |
22 | 1294137 | 1294337 | - | NC_013523.1 | Sphaerobacter thermophilus DSM 20745 |
23 | 1630750 | 1630947 | - | NZ_LR134379.1 | Slackia heliotrinireducens |
24 | 1255766 | 1255960 | - | NZ_AP019367.1 | Parolsenella catena |
25 | 1132262 | 1132459 | + | NC_022567.1 | Adlercreutzia equolifaciens DSM 19450 |
26 | 605500 | 605700 | + | NC_013203.1 | Lancefieldella parvulum DSM 20469 |
27 | 1225623 | 1225820 | - | NZ_LT635455.1 | Olsenella timonensis |
28 | 836863 | 837057 | + | NC_014363.1 | Olsenella uli DSM 7084 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00453.20 | 1.0 | 28 | 37.5 | same-strand | Ribosomal protein L20 |
2 | PF00707.24 | 0.86 | 24 | 3.5 | same-strand | Translation initiation factor IF-3, C-terminal domain |