| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | CP000027.1 |
| Organism | Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) (Dehalococcoides ethenogenes (strain 195)) |
| Left | 1207446 |
| Right | 1207733 |
| Strand | + |
| Nucleotide Sequence | ATGAAGCTAAACCGCGAAGATGTACTCCACATTGCCCGCTTGGCTAAACTGGGGCTGGAGGAAGATGAAATAAACCGCTTGAGTAAAGAGCTTTCGGCCTTGCTGGAGCATTTTGAGGTACTGCAGCAGGTGGATACCACCGGCGTAGAGCCGACCGCCCAATCCACCCCGGTTAAAAGCGTACTTAAAGAGGATATTATAAAGCCCTCTTATGACCGTGAGGAGATACTTTCAAATGCCCCCAGACGCGAGGGTGATTACGTGCGGATACGGGCGGTGATGGAATAA |
| Sequence | MKLNREDVLHIARLAKLGLEEDEINRLSKELSALLEHFEVLQQVDTTGVEPTAQSTPVKSVLKEDIIKPSYDREEILSNAPRREGDYVRIRAVME |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | 15637277 |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | Q3Z6V4 |
| ORF Length (Amino Acid) | 95 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1123200 | 1123487 | + | NZ_CP006950.1 | Dehalococcoides mccartyi CG4 |
| 2 | 1035492 | 1035779 | + | NC_014314.1 | Dehalogenimonas lykanthroporepellens BL-DC-9 |
| 3 | 239907 | 240194 | + | NZ_CP042829.1 | Tepidiforma bonchosmolovskayae |
| 4 | 353972 | 354259 | + | NZ_CP018258.1 | Dehalogenimonas formicexedens |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01425.23 | 1.0 | 4 | 10 | same-strand | Amidase |