Protein Information |
Information Type | Description |
---|---|
Protein name | Sec-independent protein translocase protein TatA |
NCBI Accession ID | CP000027.1 |
Organism | Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) (Dehalococcoides ethenogenes (strain 195)) |
Left | 1436588 |
Right | 1436785 |
Strand | - |
Nucleotide Sequence | ATGCCTAAGATTGGTCCTATGGAAATACTTATCATAGTTCTTTTGGTTGTAGTGGTGTTCGGTATAGGCAAACTTCCTCAGGTCGGAGATGCTATCGGCAAGGGCATCAGAAACTTCAGGAAGGCTTCCTCCGGTGAAGAAGAAAAAGAGGAAGTTGAAACCAAGGAAGAAACCAAGACCATTGAAAAATCAGAATAA |
Sequence | MPKIGPMEILIIVLLVVVVFGIGKLPQVGDAIGKGIRNFRKASSGEEEKEEVETKEETKTIEKSE |
Source of smORF | Swiss-Prot |
Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
Pubmed ID | 15637277 |
Domain | |
Functional Category | Others |
Uniprot ID | Q3Z652 |
ORF Length (Amino Acid) | 65 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1349178 | 1349375 | - | NZ_CP006950.1 | Dehalococcoides mccartyi CG4 |
2 | 1027655 | 1027837 | + | NZ_CP009788.1 | Geobacter pickeringii |
3 | 1835025 | 1835186 | - | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
4 | 892935 | 893099 | + | NZ_CP046996.1 | Dehalobacter restrictus |
5 | 2308971 | 2309132 | - | NC_007759.1 | Syntrophus aciditrophicus SB |
6 | 1485830 | 1486015 | - | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF12838.9 | 0.67 | 4 | 1686 | same-strand | 4Fe-4S dicluster domain |
2 | PF13237.8 | 0.67 | 4 | 1686 | same-strand | 4Fe-4S dicluster domain |