Result : Q3Z652
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | CP000027.1 |
| Organism | Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) (Dehalococcoides ethenogenes (strain 195)) |
| Left | 1436588 |
| Right | 1436785 |
| Strand | - |
| Nucleotide Sequence | ATGCCTAAGATTGGTCCTATGGAAATACTTATCATAGTTCTTTTGGTTGTAGTGGTGTTCGGTATAGGCAAACTTCCTCAGGTCGGAGATGCTATCGGCAAGGGCATCAGAAACTTCAGGAAGGCTTCCTCCGGTGAAGAAGAAAAAGAGGAAGTTGAAACCAAGGAAGAAACCAAGACCATTGAAAAATCAGAATAA |
| Sequence | MPKIGPMEILIIVLLVVVVFGIGKLPQVGDAIGKGIRNFRKASSGEEEKEEVETKEETKTIEKSE |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | 15637277 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q3Z652 |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1349178 | 1349375 | - | NZ_CP006950.1 | Dehalococcoides mccartyi CG4 |
| 2 | 1027655 | 1027837 | + | NZ_CP009788.1 | Geobacter pickeringii |
| 3 | 1835025 | 1835186 | - | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 4 | 892935 | 893099 | + | NZ_CP046996.1 | Dehalobacter restrictus |
| 5 | 2308971 | 2309132 | - | NC_007759.1 | Syntrophus aciditrophicus SB |
| 6 | 1485830 | 1486015 | - | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP009788.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12838.9 | 0.67 | 4 | 1686 | same-strand | 4Fe-4S dicluster domain |
| 2 | PF13237.8 | 0.67 | 4 | 1686 | same-strand | 4Fe-4S dicluster domain |
++ More..