Result : A0L835
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | CP000471.1 |
| Organism | Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) |
| Left | 2006070 |
| Right | 2006279 |
| Strand | - |
| Nucleotide Sequence | ATGTTTGGTTTGGGTACCATGGAGATGGTCATCATTTTGGTGATTGTTTTGGTTATCTTCGGTGCGGGCAAGCTGCCCAAGGTGATGGGCGACATGGGTCGCGGCGTAAAGAGCTTTAAAAAAGCGATGAATGCAGAGGATGATGCGCCTGCTGAGCCCGAGGTGAGCAAGCCCGCTGCGGCGGAATCCACGGAGAAAAAAGACGCCTAA |
| Sequence | MFGLGTMEMVIILVIVLVIFGAGKLPKVMGDMGRGVKSFKKAMNAEDDAPAEPEVSKPAAAESTEKKDA |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | 19465526 |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | A0L835 |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2006070 | 2006279 | - | NC_008576.1 | Magnetococcus marinus MC-1 |
| 2 | 2038794 | 2039024 | + | NZ_CP004388.1 | Thalassospira xiamenensis M-5 = DSM 17429 |
| 3 | 2545557 | 2545793 | + | NZ_CP031555.1 | Thalassospira indica |
| 4 | 1874298 | 1874522 | + | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 5 | 2011960 | 2012181 | + | NZ_CP024199.1 | Thalassospira marina |
| 6 | 984951 | 985166 | + | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 7 | 3163774 | 3163989 | - | NC_013943.1 | Denitrovibrio acetiphilus DSM 12809 |
| 8 | 1384645 | 1384845 | - | NC_014836.1 | Desulfurispirillum indicum S5 |
| 9 | 5054640 | 5054822 | - | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 10 | 2428228 | 2428422 | + | NZ_CP014230.1 | Desulfomicrobium orale DSM 12838 |
| 11 | 3791944 | 3792126 | + | NZ_AP021875.1 | Desulfosarcina widdelii |
| 12 | 3202046 | 3202261 | - | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
++ More..