ProsmORF-pred
Result : Q3YL95
Protein Information
Information Type Description
Protein name Immunity protein CdiI
NCBI Accession ID DQ100454.1
Organism Escherichia coli
Left 13671
Right 13910
Strand +
Nucleotide Sequence ATGAAGAAGAAACTATTTGCCCTTTTAAAATATATTATTTTTTTTCCTATGCTATGTACTGTACTTGGTCTTTTAGGTATACCTATAGGTTTAATTGTGAATTTTTTGAGAACGGGCTCTTTTGACTTCAACTTAAAAGATGAAATTGATGTTGTTTTATTCACTTTAAAAATAGGAATCCCCATAGGCTTTATTCTTGGGCTGGGTTTGTGGGGCCTTAGTATCTTAGACAGAAAATAG
Sequence MKKKLFALLKYIIFFPMLCTVLGLLGIPIGLIVNFLRTGSFDFNLKDEIDVVLFTLKIGIPIGFILGLGLWGLSILDRK
Source of smORF Swiss-Prot
Function Immunity protein component of a toxin-immunity protein module, which functions as a cellular contact-dependent growth inhibition (CDI) system. CDI modules allow bacteria to communicate with and inhibit the growth of closely related neighboring bacteria in a contact-dependent fashion. Protects cells against CdiA from the same strain, its cognate toxin protein (Pubmed:16109881, Pubmed:23882017). Growth inhibition is reversible upon induction of this protein, occurring about 2.5 hours after induction, and requires an energy source (Pubmed:19124575). Does not protect against non-cognate CdiA from E.coli strain 563 / UPEC, D.dadantii strain 3937 or Y.pestis strain CO92 (Pubmed:21085179). {ECO:0000269|Pubmed:16109881, ECO:0000269|Pubmed:19124575, ECO:0000269|Pubmed:21085179, ECO:0000269|Pubmed:23882017}.
Pubmed ID 16109881 19124575 21085179 23882017
Domain
Functional Category Others
Uniprot ID Q3YL95
ORF Length (Amino Acid) 79
++ More..