ProsmORF-pred
Result : Q3MGJ7
Protein Information
Information Type Description
Protein name Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit)
NCBI Accession ID CP000117.1
Organism Trichormus variabilis (strain ATCC 29413 / PCC 7937) (Anabaena variabilis)
Left 336783
Right 337067
Strand +
Nucleotide Sequence ATGGTTAAACGTAAAAACTCTGACAATTCAGGTACTGTGGCACAGGGTAATTATGAAGCCAAGGTTGCAGAAATAGAAGCCATCATCTCACGGATTGAATCAGGAGAATTGGAACTAGAAACCGTTTTTGAGCAGTTTGCCAACGCCGTTCAATACCTGCGTCAATGCGACACTTTTTTACAGCAACGACAGCAACAAATAGATTTATTAATTGAAACTTTGAATGAGCAAGACGGTGATCAGATACCCAGGGTCTCCAATGATGGTATTGAGCCAAAGAAATGA
Sequence MVKRKNSDNSGTVAQGNYEAKVAEIEAIISRIESGELELETVFEQFANAVQYLRQCDTFLQQRQQQIDLLIETLNEQDGDQIPRVSNDGIEPKK
Source of smORF Swiss-Prot
Function Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}.
Pubmed ID 25197444
Domain CDD:412547
Functional Category Others
Uniprot ID Q3MGJ7
ORF Length (Amino Acid) 94
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 2
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1629298 1629582 + NZ_CP047242.1 Trichormus variabilis 0441
2 95182 95415 - NC_019689.1 Pleurocapsa sp. PCC 7327
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_CP047242.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF13742.8 1.0 2 6.0 same-strand OB-fold nucleic acid binding domain
2 PF01336.27 1.0 2 6.0 same-strand OB-fold nucleic acid binding domain
++ More..