| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | CP000117.1 |
| Organism | Trichormus variabilis (strain ATCC 29413 / PCC 7937) (Anabaena variabilis) |
| Left | 336783 |
| Right | 337067 |
| Strand | + |
| Nucleotide Sequence | ATGGTTAAACGTAAAAACTCTGACAATTCAGGTACTGTGGCACAGGGTAATTATGAAGCCAAGGTTGCAGAAATAGAAGCCATCATCTCACGGATTGAATCAGGAGAATTGGAACTAGAAACCGTTTTTGAGCAGTTTGCCAACGCCGTTCAATACCTGCGTCAATGCGACACTTTTTTACAGCAACGACAGCAACAAATAGATTTATTAATTGAAACTTTGAATGAGCAAGACGGTGATCAGATACCCAGGGTCTCCAATGATGGTATTGAGCCAAAGAAATGA |
| Sequence | MVKRKNSDNSGTVAQGNYEAKVAEIEAIISRIESGELELETVFEQFANAVQYLRQCDTFLQQRQQQIDLLIETLNEQDGDQIPRVSNDGIEPKK |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | 25197444 |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | Q3MGJ7 |
| ORF Length (Amino Acid) | 94 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1629298 | 1629582 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 2 | 95182 | 95415 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13742.8 | 1.0 | 2 | 6.0 | same-strand | OB-fold nucleic acid binding domain |
| 2 | PF01336.27 | 1.0 | 2 | 6.0 | same-strand | OB-fold nucleic acid binding domain |