Result : Q3M446
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S21 3 |
| NCBI Accession ID | CP000117.1 |
| Organism | Trichormus variabilis (strain ATCC 29413 / PCC 7937) (Anabaena variabilis) |
| Left | 5806323 |
| Right | 5806511 |
| Strand | + |
| Nucleotide Sequence | ATGACCCAAATAGTAGTGGGTGAGAATGAACACATTGAGTCAGCCTTACGCCGATTCAAGCGAGAAGTTTCCAAAGCGGGAATTTTCCAAGACATGAGGAAACACCGTCACTTTGAAACGCCTATTGAAAAAAGCAAGCGCAAAAAACTCGCCTTGCACAAACAAAGCAAAAGACGTTTCCGTACCTAA |
| Sequence | MTQIVVGENEHIESALRRFKREVSKAGIFQDMRKHRHFETPIEKSKRKKLALHKQSKRRFRT |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00529. Profile Description: Ribosomal protein S21. 30S ribosomal protein S21; Reviewed |
| Pubmed ID | 25197444 |
| Domain | CDD:412427 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q3M446 |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 115
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 740992 | 741180 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 2 | 505399 | 505575 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 3 | 475461 | 475649 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 4 | 1801274 | 1801465 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 5 | 3541844 | 3542038 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 6 | 5549416 | 5549595 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 7 | 3590484 | 3590672 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 8 | 7149920 | 7150111 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 9 | 6080097 | 6080276 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 10 | 2379068 | 2379256 | - | NZ_CP031941.1 | Nostoc sphaeroides |
| 11 | 2911977 | 2912168 | - | NZ_CP031941.1 | Nostoc sphaeroides |
| 12 | 3940917 | 3941096 | - | NZ_CP031941.1 | Nostoc sphaeroides |
| 13 | 1135410 | 1135598 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 14 | 5407215 | 5407394 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 15 | 2899409 | 2899603 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 16 | 2895862 | 2896041 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 17 | 4768650 | 4768844 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
| 18 | 2792066 | 2792254 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 19 | 3397714 | 3397908 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 20 | 2744329 | 2744505 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 21 | 3079725 | 3079916 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 22 | 832008 | 832184 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 23 | 3053971 | 3054162 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 24 | 5271782 | 5271961 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 25 | 52976 | 53164 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 26 | 394558 | 394737 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 27 | 5429517 | 5429708 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
| 28 | 4154470 | 4154649 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
| 29 | 3298411 | 3298605 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 30 | 2709105 | 2709314 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 31 | 2764758 | 2764940 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 32 | 2531777 | 2531965 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 33 | 2858496 | 2858672 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 34 | 3589189 | 3589365 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 35 | 2356339 | 2356515 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 36 | 3671511 | 3671693 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 37 | 1335551 | 1335730 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 38 | 158248 | 158424 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 39 | 556189 | 556368 | - | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 40 | 2656554 | 2656745 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 41 | 5609413 | 5609583 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 42 | 1082717 | 1082899 | + | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 43 | 2383278 | 2383457 | + | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 44 | 2388962 | 2389138 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 45 | 910343 | 910519 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 46 | 3140877 | 3141053 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 47 | 891560 | 891736 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 48 | 488354 | 488530 | + | NZ_CP020953.1 | Clostridium drakei |
| 49 | 5259682 | 5259858 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 50 | 3758754 | 3758930 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 51 | 2054960 | 2055121 | - | NC_015520.1 | Mahella australiensis 50-1 BON |
| 52 | 2317242 | 2317418 | - | NZ_CP032416.1 | Clostridium fermenticellae |
| 53 | 511737 | 511913 | - | NZ_CP023671.1 | Clostridium septicum |
| 54 | 2475277 | 2475453 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 55 | 2930027 | 2930203 | - | NZ_CP030775.1 | Clostridium butyricum |
| 56 | 1216535 | 1216711 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 57 | 585225 | 585398 | + | NZ_CP029256.1 | Christensenella minuta |
| 58 | 1433968 | 1434144 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 59 | 1434126 | 1434302 | - | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 60 | 2586090 | 2586266 | - | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 61 | 991318 | 991497 | + | NZ_LT906470.1 | Veillonella rodentium |
| 62 | 1059046 | 1059225 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 63 | 1115491 | 1115670 | - | NZ_LR134375.1 | Veillonella dispar |
| 64 | 1159269 | 1159448 | - | NZ_LR778174.1 | Veillonella parvula |
| 65 | 2054172 | 2054348 | - | NZ_CP017194.1 | Lactococcus carnosus |
| 66 | 935730 | 935906 | - | NZ_CP023392.1 | Lactococcus raffinolactis |
| 67 | 107427 | 107603 | + | NZ_CP017195.1 | Lactococcus paracarnosus |
| 68 | 2384444 | 2384620 | + | NZ_CP032627.1 | Lactococcus allomyrinae |
| 69 | 3196418 | 3196594 | - | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 70 | 985641 | 985817 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 71 | 1476261 | 1476437 | + | NZ_LR699011.1 | Roseburia hominis |
| 72 | 1749935 | 1750111 | + | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 73 | 338681 | 338854 | + | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 74 | 413677 | 413853 | + | NZ_CP070872.1 | Lactococcus taiwanensis |
| 75 | 984967 | 985143 | + | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 76 | 1149329 | 1149505 | + | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
| 77 | 804554 | 804730 | + | NZ_CP025536.1 | Streptococcus pluranimalium |
| 78 | 780041 | 780217 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 79 | 3363746 | 3363922 | + | NZ_CP070062.1 | Coprococcus comes |
| 80 | 1138809 | 1138982 | + | NZ_LN879430.1 | Herbinix luporum |
| 81 | 778861 | 779037 | - | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 82 | 1137947 | 1138123 | - | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 83 | 2556306 | 2556482 | + | NZ_CP039126.1 | Blautia producta |
| 84 | 1451062 | 1451238 | - | NZ_LR134275.1 | Streptococcus vestibularis |
| 85 | 1519361 | 1519537 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 86 | 305384 | 305560 | - | NZ_LT990039.1 | Massilistercora timonensis |
| 87 | 3018891 | 3019067 | - | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 88 | 1326469 | 1326645 | + | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 89 | 2098137 | 2098313 | - | NZ_CP030280.1 | Blautia argi |
| 90 | 1447705 | 1447881 | - | NZ_CP029491.1 | Streptococcus sobrinus |
| 91 | 1623330 | 1623506 | + | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 92 | 1959253 | 1959429 | - | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 93 | 4023167 | 4023340 | - | NZ_LR134338.1 | Brevibacillus brevis |
| 94 | 2293783 | 2293959 | - | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 95 | 1086994 | 1087170 | - | NZ_LT906439.1 | Streptococcus merionis |
| 96 | 1101230 | 1101406 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 97 | 1056872 | 1057048 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 98 | 1304728 | 1304904 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 99 | 1362849 | 1363025 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 100 | 4052996 | 4053169 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 101 | 734211 | 734384 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 102 | 4426840 | 4427013 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 103 | 1148038 | 1148214 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 104 | 1250669 | 1250845 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 105 | 219951 | 220127 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 106 | 3366174 | 3366347 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 107 | 1518580 | 1518756 | - | NZ_CP054482.1 | Macrococcus bohemicus |
| 108 | 2050309 | 2050485 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 109 | 1288149 | 1288325 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 110 | 489233 | 489409 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 111 | 591179 | 591355 | + | NZ_CP010450.1 | Streptococcus pyogenes |
| 112 | 914604 | 914780 | + | NZ_CP012805.1 | Streptococcus anginosus |
| 113 | 1309939 | 1310115 | - | NZ_LR594049.1 | Streptococcus gordonii |
| 114 | 2031130 | 2031306 | + | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 115 | 1148005 | 1148181 | - | NZ_LR594050.1 | Streptococcus porcinus |
| 116 | 2884262 | 2884438 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 117 | 1140099 | 1140275 | - | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 118 | 1121518 | 1121691 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 119 | 341225 | 341401 | + | NZ_CP065729.1 | Macrococcus caseolyticus |
| 120 | 1375282 | 1375458 | - | NZ_CP047361.1 | Macrococcus canis |
| 121 | 1930991 | 1931173 | + | NZ_CP019323.1 | Companilactobacillus allii |
| 122 | 795372 | 795548 | - | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 123 | 1989939 | 1990115 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 124 | 1028877 | 1029059 | + | NZ_CP017996.1 | Companilactobacillus crustorum |
| 125 | 1126558 | 1126740 | - | NZ_CP049366.1 | Companilactobacillus pabuli |
| 126 | 1332994 | 1333176 | + | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 127 | 1231896 | 1232078 | + | NZ_CP040736.1 | Companilactobacillus futsaii |
| 128 | 1314416 | 1314598 | - | NZ_CP012559.1 | Companilactobacillus heilongjiangensis |
| 129 | 500614 | 500802 | + | NZ_CP031513.1 | Bombilactobacillus bombi |
| 130 | 2624555 | 2624740 | + | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 131 | 1656766 | 1656942 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 132 | 3445421 | 3445597 | + | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 133 | 2243064 | 2243240 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
++ More..