Result : A7Z7F5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Small, acid-soluble spore protein I (SASP I) |
| NCBI Accession ID | CP000560.2 |
| Organism | Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42) (Bacillus amyloliquefaciens subsp. plantarum) |
| Left | 2695714 |
| Right | 2695929 |
| Strand | + |
| Nucleotide Sequence | ATGGACCTTAATTTACGCAACGCCGTTATTGCCAATGTAACCGGCAATAACCAGGATCAGCTGGAGCATACTATCGTTGACGCCATCCAAAGCGGTGAAGAAAAAATGCTTCCGGGCCTCGGCGTCTTATTCGAAGTTCTTTGGCAGCATGCGTCGGACTCAGAAAAAAATGAAATGCTCAAAACACTTGAAGGCGGATTAAAACCTGCGCAATAA |
| Sequence | MDLNLRNAVIANVTGNNQDQLEHTIVDAIQSGEEKMLPGLGVLFEVLWQHASDSEKNEMLKTLEGGLKPAQ |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl07940. Profile Description: Small, acid-soluble spore protein I. small acid-soluble spore protein SspI; Provisional |
| Pubmed ID | 17704766 |
| Domain | CDD:415450 |
| Functional Category | Others |
| Uniprot ID | A7Z7F5 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 74
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1216619 | 1216834 | - | NZ_CP011937.1 | Bacillus velezensis |
| 2 | 2771049 | 2771264 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 3 | 2748679 | 2748894 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 2815165 | 2815380 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 2742123 | 2742338 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 6 | 2808590 | 2808805 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 7 | 2931692 | 2931907 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 8 | 2736697 | 2736912 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 9 | 3364872 | 3365087 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 10 | 3274409 | 3274624 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 2735409 | 2735630 | - | NZ_CP043404.1 | Bacillus safensis |
| 12 | 2903106 | 2903318 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 13 | 3086298 | 3086510 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 14 | 2824165 | 2824386 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 15 | 2568279 | 2568500 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 16 | 4157109 | 4157318 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 17 | 1061993 | 1062202 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 18 | 3702288 | 3702500 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 19 | 3150442 | 3150648 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 20 | 1454538 | 1454744 | - | NZ_LS483476.1 | Lederbergia lentus |
| 21 | 803631 | 803840 | - | NZ_CP040336.1 | Bacillus luti |
| 22 | 4395430 | 4395639 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 23 | 4371137 | 4371346 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 24 | 1009810 | 1010019 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 25 | 3254753 | 3254959 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 26 | 4564740 | 4564949 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 27 | 3575349 | 3575555 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 28 | 3754460 | 3754666 | + | NZ_CP053989.1 | Niallia circulans |
| 29 | 3314113 | 3314325 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 30 | 1420393 | 1420602 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 31 | 3622846 | 3623052 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 32 | 2489622 | 2489837 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 33 | 2169357 | 2169569 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 34 | 2170509 | 2170718 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 35 | 1499030 | 1499254 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 36 | 3332571 | 3332777 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 37 | 2470605 | 2470811 | + | NZ_CP012024.1 | Bacillus smithii |
| 38 | 1266415 | 1266639 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 39 | 1820370 | 1820591 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 40 | 4504860 | 4505066 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 41 | 3251174 | 3251398 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 42 | 2225093 | 2225308 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 43 | 1215468 | 1215683 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 44 | 3980968 | 3981192 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 45 | 1011427 | 1011645 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 46 | 2975670 | 2975876 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 47 | 979091 | 979303 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 48 | 2737903 | 2738112 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 49 | 2740912 | 2741133 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 50 | 2694431 | 2694649 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 51 | 3187769 | 3187978 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 52 | 2735162 | 2735371 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 53 | 2395655 | 2395873 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 54 | 2366636 | 2366845 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 55 | 553053 | 553262 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 56 | 1953127 | 1953336 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 57 | 1183477 | 1183686 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 58 | 1723171 | 1723389 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 59 | 3654986 | 3655201 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 60 | 2193897 | 2194100 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 61 | 51312 | 51521 | + | NZ_CP015439.1 | Anoxybacillus amylolyticus |
| 62 | 3232803 | 3233009 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 63 | 3396988 | 3397194 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 64 | 2918501 | 2918680 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 65 | 2206407 | 2206616 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 66 | 1453787 | 1453993 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 67 | 1604096 | 1604302 | + | NZ_CP035485.1 | Salicibibacter halophilus |
| 68 | 2015552 | 2015764 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 69 | 2836259 | 2836468 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 70 | 4227101 | 4227292 | + | NZ_CP026363.1 | Brevibacillus agri |
| 71 | 2145851 | 2146069 | - | NZ_CP053187.1 | Turicibacter sanguinis |
| 72 | 4481882 | 4482073 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 73 | 1038896 | 1039087 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 74 | 3405764 | 3405985 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP011937.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00588.21 | 0.97 | 72 | 119.0 | opposite-strand | SpoU rRNA Methylase family |
| 2 | PF08032.14 | 0.99 | 73 | 119 | opposite-strand | RNA 2'-O ribose methyltransferase substrate binding |
| 3 | PF01409.22 | 0.93 | 69 | 1232 | opposite-strand | tRNA synthetases class II core domain (F) |
| 4 | PF02912.20 | 0.93 | 69 | 1232 | opposite-strand | Aminoacyl tRNA synthetase class II, N-terminal domain |
| 5 | PF17759.3 | 0.88 | 65 | 2284 | opposite-strand | Phenylalanyl tRNA synthetase beta chain CLM domain |
| 6 | PF03483.19 | 0.88 | 65 | 2284 | opposite-strand | B3/4 domain |
| 7 | PF03147.16 | 0.88 | 65 | 2284 | opposite-strand | Ferredoxin-fold anticodon binding domain |
| 8 | PF01588.22 | 0.88 | 65 | 2284 | opposite-strand | Putative tRNA binding domain |
| 9 | PF03484.17 | 0.88 | 65 | 2284 | opposite-strand | tRNA synthetase B5 domain |
++ More..