Result : Q3JCK6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Translational regulator CsrA (Carbon storage regulator) |
| NCBI Accession ID | CP000127.1 |
| Organism | Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / NCIMB 11848 / C-107) |
| Left | 1025384 |
| Right | 1025641 |
| Strand | + |
| Nucleotide Sequence | ATGTTGATTTTGACTCGGCGCGTTGGCGAAGCCTTGATGATTGGAGATCAGGTCACGGTGACAGTGCTAGGCGTAAAGGGTAATCAGGTAAGAATTGGGGTGACAGCACCTAAGGAAGTCACGGTTCATAGGGAAGAGATTTACGCACGCATTCAGCGTGAAAAGGAGCAAGCTAACGGTAGGGGGCAAGTCAGCGAGTCAGAGTTTACGGAAGAAGCGTTTCGGGCTGCGCCTGCTATTTCCGGAAGTGGCGAGTAA |
| Sequence | MLILTRRVGEALMIGDQVTVTVLGVKGNQVRIGVTAPKEVTVHREEIYARIQREKEQANGRGQVSESEFTEEAFRAAPAISGSGE |
| Source of smORF | Swiss-Prot |
| Function | A key translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Mediates global changes in gene expression, shifting from rapid growth to stress survival by linking envelope stress, the stringent response and the catabolite repression systems. Usually binds in the 5'-UTR; binding at or near the Shine-Dalgarno sequence prevents ribosome-binding, repressing translation, binding elsewhere in the 5'-UTR can activate translation and/or stabilize the mRNA. Its function is antagonized by small RNA(s). {ECO:0000255|HAMAP-Rule:MF_00167}. |
| Pubmed ID | 16957257 |
| Domain | CDD:412510 |
| Functional Category | RNA-binding |
| Uniprot ID | Q3JCK6 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 33
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1025384 | 1025641 | + | NC_007484.1 | Nitrosococcus oceani ATCC 19707 |
| 2 | 830956 | 831213 | + | NC_014315.1 | Nitrosococcus watsonii C-113 |
| 3 | 1120882 | 1121139 | + | NC_013960.1 | Nitrosococcus halophilus Nc 4 |
| 4 | 3728293 | 3728550 | - | NZ_CP038033.1 | Nitrosococcus wardiae |
| 5 | 1967888 | 1968094 | - | NZ_AP018725.1 | Sulfuriflexus mobilis |
| 6 | 1126811 | 1127071 | - | NZ_CP049916.1 | Acinetobacter lanii |
| 7 | 1322888 | 1323100 | - | NZ_CP012418.1 | Kangiella sediminilitoris |
| 8 | 2312464 | 2312718 | + | NZ_CP049801.1 | Acinetobacter shaoyimingii |
| 9 | 1318360 | 1318614 | - | NZ_CP035934.2 | Acinetobacter cumulans |
| 10 | 1317701 | 1317928 | - | NZ_CP010975.1 | Kangiella geojedonensis |
| 11 | 2118725 | 2118979 | + | NZ_CP032134.1 | Acinetobacter chinensis |
| 12 | 1179622 | 1179882 | - | NZ_CP029397.2 | Acinetobacter defluvii |
| 13 | 1518363 | 1518617 | - | NZ_CP071766.1 | Acinetobacter towneri |
| 14 | 701827 | 702081 | + | NZ_CP070518.1 | Acinetobacter calcoaceticus |
| 15 | 1886768 | 1887007 | + | NZ_CP031222.1 | Aquirhabdus parva |
| 16 | 2885822 | 2886073 | + | NZ_CP012808.1 | Acinetobacter equi |
| 17 | 2560145 | 2560399 | + | NZ_CP016895.1 | Acinetobacter larvae |
| 18 | 2208779 | 2209042 | + | NZ_CP030880.1 | Acinetobacter haemolyticus |
| 19 | 810094 | 810300 | + | NC_022664.1 | Spiribacter curvatus |
| 20 | 853302 | 853565 | + | NZ_CP013816.1 | Piscirickettsia salmonis |
| 21 | 2456348 | 2456560 | + | NZ_CP061081.1 | Marinomonas arctica |
| 22 | 1688435 | 1688698 | + | NZ_CP041970.1 | Acinetobacter dispersus |
| 23 | 2893194 | 2893448 | + | NC_014259.1 | Acinetobacter oleivorans DR1 |
| 24 | 1656938 | 1657186 | - | NZ_CP065728.1 | Moraxella nonliquefaciens |
| 25 | 941145 | 941393 | + | NZ_CP030241.1 | Moraxella bovis |
| 26 | 817169 | 817417 | - | NZ_CP011381.2 | Moraxella bovoculi |
| 27 | 887151 | 887399 | - | NZ_CP011158.1 | Moraxella ovis |
| 28 | 3833010 | 3833222 | - | NZ_CP070273.1 | Marinomonas foliarum |
| 29 | 263835 | 264077 | + | NZ_CP036422.1 | Halioglobus maricola |
| 30 | 1326523 | 1326738 | + | NZ_CP046570.1 | Xanthomonas albilineans |
| 31 | 501548 | 501793 | + | NZ_LR884459.1 | Psychrobacter arenosus |
| 32 | 993197 | 993409 | - | NC_002971.4 | Coxiella burnetii RSA 493 |
| 33 | 1451237 | 1451446 | + | NZ_AP014936.1 | Sulfurifustis variabilis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007484.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01411.21 | 0.88 | 29 | 1586 | same-strand | tRNA synthetases class II (A) |
| 2 | PF02272.21 | 0.88 | 29 | 1586 | same-strand | DHHA1 domain |
| 3 | PF07973.16 | 0.88 | 29 | 1586 | same-strand | Threonyl and Alanyl tRNA synthetase second additional domain |
| 4 | PF00696.30 | 0.79 | 26 | 242.5 | same-strand | Amino acid kinase family |
| 5 | PF13840.8 | 0.79 | 26 | 242.5 | same-strand | ACT domain |
| 6 | PF01842.27 | 0.79 | 26 | 242.5 | same-strand | ACT domain |
++ More..