Result : Q3J7V8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | CP000127.1 |
| Organism | Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / NCIMB 11848 / C-107) |
| Left | 2989717 |
| Right | 2990004 |
| Strand | + |
| Nucleotide Sequence | ATGACATTAAAAACGGCGGATGTTGAATATATCGCCCATTTGGCTCGCCTTGCTATCGACTCGGAGGCTATTCCTCATTACAAGCATGATTTAAGCCGAATCCTTGAGTTCGTGGGACAAATGAATAAAGTTGACACTACCAATATCGAGCCCATGGCCCACCCTTTAGACGCCATTCAGCGACTACGTCCTGACGAAGTCACCGAAAGTGATCAGTGGAGGACCTTTCAATCTATTGCTCCCCAGGTTGAGGCAGGCGTCTACTTAATCCCTAAAGTTATTGATTAA |
| Sequence | MTLKTADVEYIAHLARLAIDSEAIPHYKHDLSRILEFVGQMNKVDTTNIEPMAHPLDAIQRLRPDEVTESDQWRTFQSIAPQVEAGVYLIPKVID |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | 16957257 |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | Q3J7V8 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 133
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2989717 | 2990004 | + | NC_007484.1 | Nitrosococcus oceani ATCC 19707 |
| 2 | 501685 | 501972 | - | NC_014315.1 | Nitrosococcus watsonii C-113 |
| 3 | 581873 | 582160 | - | NC_013960.1 | Nitrosococcus halophilus Nc 4 |
| 4 | 275787 | 276074 | + | NZ_CP038033.1 | Nitrosococcus wardiae |
| 5 | 199448 | 199735 | - | NC_008340.1 | Alkalilimnicola ehrlichii MLHE-1 |
| 6 | 4131344 | 4131631 | - | NZ_CP012373.2 | Beggiatoa leptomitoformis |
| 7 | 2571403 | 2571690 | - | NZ_AP018724.1 | Sulfurivermis fontis |
| 8 | 2645168 | 2645455 | + | NC_017857.3 | Methylophaga nitratireducenticrescens |
| 9 | 3895450 | 3895737 | - | NC_016112.1 | Methylotuvimicrobium alcaliphilum 20Z |
| 10 | 1210178 | 1210465 | + | NC_017856.1 | Methylophaga frappieri |
| 11 | 2638887 | 2639174 | - | NZ_AP017372.2 | Halorhodospira halochloris |
| 12 | 1135694 | 1135981 | + | NC_015572.1 | Methylomonas methanica MC09 |
| 13 | 4430608 | 4430895 | - | NZ_CP043929.1 | Methylomonas rhizoryzae |
| 14 | 142471 | 142758 | - | NZ_CP013816.1 | Piscirickettsia salmonis |
| 15 | 3000993 | 3001280 | - | NZ_CP014476.1 | Methylomonas denitrificans |
| 16 | 106353 | 106640 | - | NC_002977.6 | Methylococcus capsulatus str. Bath |
| 17 | 4562141 | 4562428 | - | NZ_CP031146.1 | Pseudomonas plecoglossicida |
| 18 | 3652535 | 3652822 | - | NZ_AP017928.1 | Methylocaldum marinum |
| 19 | 1102645 | 1102932 | - | NZ_CP022562.1 | Pseudomonas monteilii |
| 20 | 4956008 | 4956295 | + | NC_021505.1 | Pseudomonas putida NBRC 14164 |
| 21 | 4169255 | 4169542 | - | NC_018012.1 | Thiocystis violascens DSM 198 |
| 22 | 368515 | 368802 | + | NZ_CP017415.1 | Acidihalobacter yilgarnenesis |
| 23 | 796925 | 797212 | + | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
| 24 | 1297972 | 1298259 | - | NZ_CP015839.1 | Marinobacterium aestuarii |
| 25 | 1076409 | 1076696 | - | NC_008789.1 | Halorhodospira halophila SL1 |
| 26 | 6190799 | 6191086 | - | NZ_CP009365.1 | Pseudomonas soli |
| 27 | 1126361 | 1126648 | - | NC_008027.1 | Pseudomonas entomophila L48 |
| 28 | 3118056 | 3118343 | + | NZ_CP011412.1 | Sedimenticola thiotaurini |
| 29 | 2845680 | 2845967 | + | NZ_CP011494.1 | Marinobacter psychrophilus |
| 30 | 1045545 | 1045832 | - | NZ_CP024159.1 | Pseudomonas mosselii |
| 31 | 2642050 | 2642337 | + | NZ_CP043869.1 | Neptunomonas concharum |
| 32 | 2337380 | 2337667 | - | NZ_CP039268.1 | Thermochromatium tepidum ATCC 43061 |
| 33 | 50559 | 50852 | + | NZ_LR699117.1 | Aquicella lusitana |
| 34 | 1539122 | 1539415 | - | NZ_LR699114.1 | Aquicella lusitana |
| 35 | 95734 | 96027 | - | NZ_LR699114.1 | Aquicella lusitana |
| 36 | 886766 | 887059 | - | NZ_LR699114.1 | Aquicella lusitana |
| 37 | 1562937 | 1563224 | + | NZ_CP045302.1 | Azotobacter salinestris |
| 38 | 449285 | 449572 | - | NZ_CP017715.1 | Marinobacter salinus |
| 39 | 5028045 | 5028332 | + | NZ_CP049044.1 | Pseudomonas psychrophila |
| 40 | 1229841 | 1230128 | - | NC_012560.1 | Azotobacter vinelandii DJ |
| 41 | 1111304 | 1111591 | - | NZ_CP011835.1 | Azotobacter chroococcum |
| 42 | 3048574 | 3048861 | + | NZ_AP014545.1 | Amphritea japonica ATCC BAA-1530 |
| 43 | 5696997 | 5697284 | + | NZ_CP007142.1 | Gynuella sunshinyii YC6258 |
| 44 | 3608901 | 3609188 | + | NZ_CP012676.1 | Pseudomonas versuta |
| 45 | 1006584 | 1006871 | - | NZ_CP061079.1 | Pseudomonas chlororaphis |
| 46 | 1223797 | 1224084 | - | NZ_CP021435.1 | Halomonas beimenensis |
| 47 | 1056502 | 1056789 | - | NC_014532.2 | Halomonas elongata DSM 2581 |
| 48 | 198478 | 198765 | + | NZ_AP014936.1 | Sulfurifustis variabilis |
| 49 | 5475038 | 5475325 | + | NC_007645.1 | Hahella chejuensis KCTC 2396 |
| 50 | 5013671 | 5013961 | + | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
| 51 | 3230482 | 3230769 | - | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 52 | 1646086 | 1646373 | - | NZ_CP048878.1 | Spartinivicinus ruber |
| 53 | 832599 | 832886 | - | NZ_CP051183.1 | Bermanella marisrubri |
| 54 | 3335250 | 3335537 | - | NZ_CP070505.1 | Pseudomonas toyotomiensis |
| 55 | 5018377 | 5018664 | + | NZ_CP007039.1 | Pseudomonas cichorii JBC1 |
| 56 | 4919799 | 4920086 | + | NZ_CP068034.2 | Pseudomonas syringae |
| 57 | 4987486 | 4987773 | + | NZ_CP042804.1 | Pseudomonas amygdali pv. tabaci str. ATCC 11528 |
| 58 | 5037595 | 5037882 | + | NC_004578.1 | Pseudomonas syringae pv. tomato str. DC3000 |
| 59 | 3961820 | 3962107 | + | NZ_CP062158.2 | Pseudomonas lundensis |
| 60 | 4232106 | 4232393 | + | NZ_CP060009.1 | Pseudomonas sediminis |
| 61 | 5444971 | 5445258 | + | NZ_CP056030.1 | Pseudomonas eucalypticola |
| 62 | 1421719 | 1422009 | + | NZ_CP011971.1 | Steroidobacter denitrificans |
| 63 | 443206 | 443493 | + | NZ_CP018139.1 | Halomonas aestuarii |
| 64 | 1190373 | 1190660 | - | NZ_CP071706.1 | Pseudomonas donghuensis |
| 65 | 2514749 | 2515036 | + | NC_007963.1 | Chromohalobacter salexigens DSM 3043 |
| 66 | 545637 | 545924 | + | NC_011901.1 | Thioalkalivibrio sulfidiphilus HL-EbGr7 |
| 67 | 978236 | 978523 | - | NZ_CP023272.1 | Pseudomonas lurida |
| 68 | 954992 | 955279 | - | NZ_CP010896.1 | Pseudomonas simiae |
| 69 | 3918748 | 3919035 | + | NZ_LR215729.2 | Pseudomonas marincola |
| 70 | 1043189 | 1043476 | - | NZ_LS999205.1 | Pseudomonas protegens CHA0 |
| 71 | 1022881 | 1023168 | - | NZ_CP029608.1 | Pseudomonas kribbensis |
| 72 | 4161930 | 4162217 | + | NZ_CP014205.2 | Pseudomonas glycinae |
| 73 | 1047084 | 1047371 | - | NZ_CP062253.1 | Pseudomonas gozinkensis |
| 74 | 5101619 | 5101906 | + | NZ_CP070503.1 | Pseudomonas atacamensis |
| 75 | 2704169 | 2704456 | - | NZ_AP018738.1 | Ferriphaselus amnicola |
| 76 | 4855866 | 4856153 | + | NZ_CP067022.1 | Pseudomonas cannabina pv. alisalensis |
| 77 | 1009948 | 1010235 | - | NZ_CP051487.1 | Pseudomonas umsongensis |
| 78 | 810940 | 811227 | - | NZ_CP009533.1 | Pseudomonas rhizosphaerae |
| 79 | 1010750 | 1011037 | - | NZ_CP035088.1 | Pseudomonas viciae |
| 80 | 3128400 | 3128687 | + | NZ_CP048810.1 | Pseudomonas bijieensis |
| 81 | 1054573 | 1054860 | - | NZ_CP034725.1 | Pseudomonas brassicacearum |
| 82 | 2720851 | 2721138 | + | NZ_CP014226.1 | Halomonas chromatireducens |
| 83 | 5679050 | 5679337 | + | NZ_CP014870.1 | Pseudomonas silesiensis |
| 84 | 536191 | 536478 | + | NZ_AP018725.1 | Sulfuriflexus mobilis |
| 85 | 1956219 | 1956506 | - | NC_015276.1 | Marinomonas mediterranea MMB-1 |
| 86 | 976970 | 977257 | - | NZ_CP043311.1 | Pseudomonas lalkuanensis |
| 87 | 105383 | 105670 | - | NC_022357.1 | Sulfuricella denitrificans skB26 |
| 88 | 2774888 | 2775175 | - | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
| 89 | 1264711 | 1264998 | - | NZ_AP022642.1 | Pseudomonas otitidis |
| 90 | 4557863 | 4558150 | - | NZ_CP014262.1 | Pseudomonas corrugata |
| 91 | 4772487 | 4772774 | + | NZ_CP046621.1 | Pseudomonas alkylphenolica |
| 92 | 214109 | 214396 | + | NZ_AP014879.1 | Sulfuricaulis limicola |
| 93 | 990531 | 990818 | - | NZ_CP068551.1 | Pseudomonas khazarica |
| 94 | 1176502 | 1176789 | - | NZ_CP054205.1 | Pseudomonas rhodesiae |
| 95 | 2865348 | 2865635 | + | NZ_CP005960.1 | Pseudomonas mandelii JR-1 |
| 96 | 950307 | 950594 | - | NZ_CP027723.1 | Pseudomonas orientalis |
| 97 | 1024513 | 1024800 | - | NZ_AP014862.1 | Pseudomonas furukawaii |
| 98 | 3759558 | 3759845 | - | NZ_CP007031.1 | Marichromatium purpuratum 984 |
| 99 | 435114 | 435401 | + | NZ_CP019343.1 | Oceanicoccus sagamiensis |
| 100 | 2931727 | 2932014 | + | NZ_CP065435.1 | Halomonas sp. SS10-MC5 |
| 101 | 4058098 | 4058385 | + | NZ_CP013124.1 | Pseudomonas mendocina S5.2 |
| 102 | 1585587 | 1585880 | + | NZ_LR699119.1 | Aquicella siphonis |
| 103 | 673885 | 674172 | - | NZ_CP011451.1 | Nitrosomonas communis |
| 104 | 3008397 | 3008684 | + | NC_014394.1 | Gallionella capsiferriformans ES-2 |
| 105 | 297777 | 298064 | + | NZ_AP012273.1 | Thiolapillus brandeum |
| 106 | 2111394 | 2111681 | - | NZ_CP021425.1 | Oleiphilus messinensis |
| 107 | 1103758 | 1104045 | - | NZ_CP027756.1 | Pseudomonas synxantha |
| 108 | 2391288 | 2391575 | + | NZ_AP022843.1 | Halomonas hydrothermalis |
| 109 | 2640666 | 2640953 | + | NZ_CP065135.1 | Halomonas venusta |
| 110 | 4269830 | 4270120 | + | NZ_CP023559.1 | Salinicola tamaricis |
| 111 | 1008664 | 1008951 | - | NZ_CP062252.1 | Pseudomonas allokribbensis |
| 112 | 3472919 | 3473206 | + | NZ_CP072793.1 | Thiothrix unzii |
| 113 | 3009422 | 3009709 | + | NZ_CP043042.1 | Marinobacter fonticola |
| 114 | 511264 | 511551 | + | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
| 115 | 1038860 | 1039147 | - | NZ_CP018420.1 | Pseudomonas veronii |
| 116 | 759453 | 759740 | - | NZ_CP012400.2 | Pseudomonas yamanorum |
| 117 | 2766042 | 2766329 | + | NZ_CP013106.1 | Halomonas huangheensis |
| 118 | 2620366 | 2620653 | - | NZ_CP011367.1 | Thioalkalivibrio versutus |
| 119 | 3020322 | 3020609 | - | NZ_CP048812.1 | Halomonas socia |
| 120 | 4833616 | 4833903 | + | NZ_CP047698.1 | Pseudomonas knackmussii |
| 121 | 2277833 | 2278120 | + | NZ_CP054301.1 | Marinomonas primoryensis |
| 122 | 800596 | 800883 | - | NZ_CP013189.1 | Pseudohongiella spirulinae |
| 123 | 3857823 | 3858110 | - | NC_018868.3 | Simiduia agarivorans SA1 = DSM 21679 |
| 124 | 3141866 | 3142153 | + | NZ_CP042382.1 | Pistricoccus aurantiacus |
| 125 | 2665119 | 2665406 | - | NC_012969.1 | Methylovorus glucosetrophus SIP3-4 |
| 126 | 5962898 | 5963185 | + | NZ_CP048833.1 | Pseudomonas multiresinivorans |
| 127 | 3071647 | 3071934 | + | NC_019940.1 | Thioflavicoccus mobilis 8321 |
| 128 | 1599768 | 1600055 | - | NC_022664.1 | Spiribacter curvatus |
| 129 | 1809764 | 1810051 | - | NC_006513.1 | Aromatoleum aromaticum EbN1 |
| 130 | 3270342 | 3270629 | + | NC_020888.1 | Thalassolituus oleivorans MIL-1 |
| 131 | 1238781 | 1239068 | - | NZ_CP014158.1 | Pseudomonas citronellolis |
| 132 | 1471471 | 1471758 | - | NZ_CP012371.1 | Nitrosospira briensis C-128 |
| 133 | 4194635 | 4194922 | + | NZ_CP059082.1 | Halomonas titanicae |
| 134 | 2668308 | 2668595 | - | NC_007947.1 | Methylobacillus flagellatus KT |
| 135 | 3159660 | 3159947 | + | NZ_CP029822.1 | Entomomonas moraniae |
| 136 | 1674501 | 1674788 | + | NC_008344.1 | Nitrosomonas eutropha C91 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013816.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01425.23 | 0.98 | 131 | 17.0 | same-strand | Amidase |
| 2 | PF06723.15 | 0.98 | 130 | 208.0 | opposite-strand | MreB/Mbl protein |
| 3 | PF14450.8 | 0.91 | 121 | 211 | opposite-strand | Cell division protein FtsA |
| 4 | PF04085.16 | 0.98 | 130 | 1408.0 | opposite-strand | rod shape-determining protein MreC |
| 5 | PF04093.14 | 0.97 | 129 | 2338 | opposite-strand | rod shape-determining protein MreD |
| 6 | PF02934.17 | 0.92 | 122 | 1485.0 | same-strand | GatB/GatE catalytic domain |
| 7 | PF02637.20 | 0.92 | 122 | 1485.0 | same-strand | GatB domain |
| 8 | PF02545.16 | 0.65 | 86 | 2959.0 | opposite-strand | Maf-like protein |
| 9 | PF10150.11 | 0.62 | 83 | 3619 | opposite-strand | Ribonuclease E/G family |
++ More..