Result : Q3J6P7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | CP000127.1 |
| Organism | Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / NCIMB 11848 / C-107) |
| Left | 3449584 |
| Right | 3449856 |
| Strand | + |
| Nucleotide Sequence | ATGGGAGTGGGTGGAATTAGTATTTGGCAGCTTCTTATTGTCTTAGTGATTATATTGCTGCTATTTGGTACCAAAAAGCTGCGCTCTATTGGCACAGATCTAGGCAGCGCCATAAAGGGCTTTCGTAATTCTTTACGCGATGAAGAGCGCCGTGATGCTGAGGAGGCAGCAACCATAGAGCATAAGCAAGCGCATAAAGCTGAAAATCCCTCCCAGAGGCAACAAGCCGATGCCGATTTCAAGATAAAATCCGGCAACGACGAGCACAAGTAA |
| Sequence | MGVGGISIWQLLIVLVIILLLFGTKKLRSIGTDLGSAIKGFRNSLRDEERRDAEEAATIEHKQAHKAENPSQRQQADADFKIKSGNDEHK |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | 16957257 |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | Q3J6P7 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 80
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3449584 | 3449856 | + | NC_007484.1 | Nitrosococcus oceani ATCC 19707 |
| 2 | 3295775 | 3296050 | + | NC_014315.1 | Nitrosococcus watsonii C-113 |
| 3 | 790224 | 790499 | + | NZ_CP038033.1 | Nitrosococcus wardiae |
| 4 | 1782126 | 1782401 | + | NZ_CP038033.1 | Nitrosococcus wardiae |
| 5 | 54065 | 54340 | - | NC_013960.1 | Nitrosococcus halophilus Nc 4 |
| 6 | 2993850 | 2994074 | + | NZ_CP029347.1 | Saliniradius amylolyticus |
| 7 | 351007 | 351240 | - | NZ_CP072844.1 | Psychrosphaera aestuarii |
| 8 | 101180 | 101434 | - | NZ_CP027523.1 | Pseudoalteromonas carrageenovora |
| 9 | 3351229 | 3351477 | - | NZ_AP014635.1 | Vibrio tritonius |
| 10 | 1902969 | 1903196 | - | NZ_CP016604.1 | Otariodibacter oris |
| 11 | 3491054 | 3491308 | + | NZ_CP033065.1 | Pseudoalteromonas agarivorans |
| 12 | 3550525 | 3550779 | + | NZ_CP023464.1 | Pseudoalteromonas atlantica |
| 13 | 3703913 | 3704146 | + | NZ_CP069213.1 | Shewanella litorisediminis |
| 14 | 422638 | 422880 | + | NZ_CP031769.1 | Salinimonas sediminis |
| 15 | 154359 | 154583 | + | NZ_CP006954.1 | Bibersteinia trehalosi USDA-ARS-USMARC-188 |
| 16 | 2015792 | 2016025 | + | NZ_CP045302.1 | Azotobacter salinestris |
| 17 | 3476444 | 3476680 | - | NZ_CP043869.1 | Neptunomonas concharum |
| 18 | 1865444 | 1865680 | + | NZ_CP072133.1 | Pseudoalteromonas xiamenensis |
| 19 | 3090199 | 3090441 | - | NZ_CP047475.1 | Vibrio astriarenae |
| 20 | 492787 | 493026 | - | NC_016901.1 | Shewanella baltica OS678 |
| 21 | 2811595 | 2811831 | - | NZ_CP022741.1 | Vibrio qinghaiensis |
| 22 | 3644387 | 3644617 | + | NZ_CP013187.1 | Pseudoalteromonas phenolica |
| 23 | 516733 | 516984 | - | NZ_CP041036.1 | Shewanella polaris |
| 24 | 1194574 | 1194807 | + | NZ_CP012362.1 | Oblitimonas alkaliphila |
| 25 | 3249570 | 3249818 | + | NC_011312.1 | Aliivibrio salmonicida LFI1238 |
| 26 | 2330073 | 2330294 | - | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
| 27 | 2809171 | 2809413 | - | NZ_AP019657.1 | Vibrio ponticus |
| 28 | 3847092 | 3847337 | - | NZ_CP017715.1 | Marinobacter salinus |
| 29 | 78524 | 78766 | + | NZ_AP019651.1 | Vibrio taketomensis |
| 30 | 3063334 | 3063576 | + | NZ_CP016414.1 | Vibrio scophthalmi |
| 31 | 528723 | 528956 | - | NZ_CP068551.1 | Pseudomonas khazarica |
| 32 | 469716 | 469955 | - | NC_011566.1 | Shewanella piezotolerans WP3 |
| 33 | 291719 | 291940 | + | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 34 | 3796274 | 3796507 | + | NC_008700.1 | Shewanella amazonensis SB2B |
| 35 | 4704191 | 4704439 | - | NZ_AP022188.1 | Aeromonas media |
| 36 | 3350288 | 3350527 | + | NC_017506.1 | Marinobacter adhaerens HP15 |
| 37 | 3504474 | 3504719 | - | NZ_CP051883.1 | Aeromonas salmonicida |
| 38 | 4489239 | 4489490 | - | NZ_LR134376.1 | Aeromonas encheleia |
| 39 | 249513 | 249749 | + | NZ_CP044069.1 | Vibrio vulnificus |
| 40 | 3923575 | 3923820 | + | NZ_CP040449.1 | Aeromonas simiae |
| 41 | 4408565 | 4408810 | + | NZ_CP020472.1 | Shewanella japonica |
| 42 | 5015224 | 5015460 | + | NC_009831.1 | Shewanella sediminis HAW-EB3 |
| 43 | 927149 | 927394 | - | NZ_CP014671.1 | Immundisolibacter cernigliae |
| 44 | 4355057 | 4355326 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 45 | 4035084 | 4035353 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 46 | 4021945 | 4022214 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 47 | 4818381 | 4818650 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 48 | 87073 | 87321 | + | NZ_CP050851.1 | Aeromonas hydrophila |
| 49 | 4312655 | 4312924 | - | NZ_LR134340.1 | Escherichia marmotae |
| 50 | 3585406 | 3585648 | + | NZ_CP011494.1 | Marinobacter psychrophilus |
| 51 | 3992446 | 3992715 | + | NZ_AP014857.1 | Escherichia albertii |
| 52 | 244090 | 244338 | - | NC_020888.1 | Thalassolituus oleivorans MIL-1 |
| 53 | 880560 | 880799 | - | NZ_CP034015.1 | Shewanella livingstonensis |
| 54 | 2665446 | 2665685 | + | NZ_CP041783.1 | Shewanella donghaensis |
| 55 | 806944 | 807171 | + | NZ_LR134167.1 | Avibacterium volantium |
| 56 | 1349128 | 1349370 | + | NZ_CP014056.2 | Grimontia hollisae |
| 57 | 236978 | 237244 | + | NC_011901.1 | Thioalkalivibrio sulfidiphilus HL-EbGr7 |
| 58 | 3529209 | 3529451 | + | NZ_CP020373.1 | Shewanella khirikhana |
| 59 | 310276 | 310521 | - | NC_017857.3 | Methylophaga nitratireducenticrescens |
| 60 | 2432734 | 2433000 | - | NZ_CP023559.1 | Salinicola tamaricis |
| 61 | 3322041 | 3322289 | + | NZ_CP011412.1 | Sedimenticola thiotaurini |
| 62 | 1994490 | 1994735 | - | NC_017856.1 | Methylophaga frappieri |
| 63 | 5371162 | 5371419 | - | NZ_CP050508.1 | Raoultella terrigena |
| 64 | 4509106 | 4509339 | + | NZ_CP013124.1 | Pseudomonas mendocina S5.2 |
| 65 | 876160 | 876429 | - | NZ_CP014143.1 | Microbulbifer aggregans |
| 66 | 5861126 | 5861383 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 67 | 3726465 | 3726707 | - | NZ_CP036536.1 | Salinimonas lutimaris |
| 68 | 3144159 | 3144425 | + | NZ_CP014226.1 | Halomonas chromatireducens |
| 69 | 427360 | 427599 | + | NZ_CP046670.1 | Alteromonas mediterranea |
| 70 | 763395 | 763637 | + | NZ_AP012273.1 | Thiolapillus brandeum |
| 71 | 557630 | 557854 | + | NZ_CP009888.1 | Pseudoalteromonas piratica |
| 72 | 540610 | 540858 | + | NZ_CP014322.1 | Alteromonas addita |
| 73 | 1098305 | 1098550 | + | NZ_CP072425.1 | Pseudoalteromonas viridis |
| 74 | 3798129 | 3798383 | - | NZ_CP012621.1 | Zobellella denitrificans |
| 75 | 574118 | 574357 | + | NZ_CP008849.1 | Alteromonas australica |
| 76 | 3597418 | 3597657 | - | NC_015554.1 | Alteromonas naphthalenivorans |
| 77 | 708396 | 708629 | - | NZ_CP011835.1 | Azotobacter chroococcum |
| 78 | 56511 | 56756 | + | NZ_CP071325.1 | Photobacterium ganghwense |
| 79 | 4405110 | 4405343 | + | NZ_LR215729.2 | Pseudomonas marincola |
| 80 | 383413 | 383661 | + | NZ_CP005974.1 | Photobacterium gaetbulicola Gung47 |
| 81 | 2872741 | 2872974 | - | NZ_CP070505.1 | Pseudomonas toyotomiensis |
| 82 | 4688062 | 4688295 | + | NZ_CP060009.1 | Pseudomonas sediminis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP029347.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00902.20 | 1.0 | 80 | 407.5 | same-strand | Sec-independent protein translocase protein (TatC) |
| 2 | PF01209.20 | 0.74 | 59 | 2346.5 | same-strand | ubiE/COQ5 methyltransferase family |
| 3 | PF13649.8 | 0.74 | 59 | 2346.5 | same-strand | Methyltransferase domain |
| 4 | PF08241.14 | 0.74 | 59 | 2346.5 | same-strand | Methyltransferase domain |
| 5 | PF13489.8 | 0.74 | 59 | 2346.5 | same-strand | Methyltransferase domain |
| 6 | PF08242.14 | 0.74 | 59 | 2346.5 | same-strand | Methyltransferase domain |
| 7 | PF02036.19 | 0.76 | 61 | 1717.0 | same-strand | SCP-2 sterol transfer family |
| 8 | PF03109.18 | 0.79 | 63 | 80.5 | same-strand | ABC1 atypical kinase-like domain |
++ More..