Protein Information |
Information Type | Description |
---|---|
Protein name | ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) |
NCBI Accession ID | CP000127.1 |
Organism | Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / NCIMB 11848 / C-107) |
Left | 3471807 |
Right | 3472091 |
Strand | - |
Nucleotide Sequence | ATGGATCCTGAACTGCTTGTGTCTATCTATGCCTCTACCGCTGTTAGTGTGGGGATCATTCTTGCCGCTGCTGGTCTTGGTTCTGCTCTGGGGTGGGGACTTATTTGTTCCAAATATCTTGAAGGTATTGCCCGGCAGCCTGAGATGCGTCCGCAATTAATGGGACAGATGCTGTTTACAGGCGGTTTGATGGAAGCATTTCCTATGATTGTTTTGGGCATGTCCATGTGGTTTATATTTGCTAATCCCTTTACTGGTGCTGCCCTGGCTGCAATCGGCAGCTAA |
Sequence | MDPELLVSIYASTAVSVGIILAAAGLGSALGWGLICSKYLEGIARQPEMRPQLMGQMLFTGGLMEAFPMIVLGMSMWFIFANPFTGAALAAIGS |
Source of smORF | Swiss-Prot |
Function | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000255|HAMAP-Rule:MF_01396}.; Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits. {ECO:0000255|HAMAP-Rule:MF_01396}. |
Pubmed ID | 16957257 |
Domain | CDD:412393 |
Functional Category | Others |
Uniprot ID | Q3J6M6 |
ORF Length (Amino Acid) | 94 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3471807 | 3472091 | - | NC_007484.1 | Nitrosococcus oceani ATCC 19707 |
2 | 3318657 | 3318941 | - | NC_014315.1 | Nitrosococcus watsonii C-113 |
3 | 853275 | 853559 | + | NZ_CP038033.1 | Nitrosococcus wardiae |
4 | 4069588 | 4069872 | - | NC_013960.1 | Nitrosococcus halophilus Nc 4 |
5 | 296454 | 296741 | + | NZ_CP072793.1 | Thiothrix unzii |
6 | 2550912 | 2551199 | - | NZ_CP046415.1 | Guyparkeria halophila |
7 | 2441797 | 2442081 | - | NZ_AP020335.1 | Hydrogenovibrio marinus |
8 | 195456 | 195740 | + | NZ_AP021888.1 | Thiosulfativibrio zosterae |
9 | 2554851 | 2555135 | - | NZ_CP035033.1 | Hydrogenovibrio thermophilus |
10 | 1850740 | 1851012 | - | NC_015581.1 | Thiomicrospira cyclica ALM1 |
11 | 2798304 | 2798588 | - | NZ_CP033040.1 | Thiomicrorhabdus indica |
12 | 2067194 | 2067466 | - | NZ_CP007030.1 | Thiomicrospira aerophila AL3 |
13 | 2562823 | 2563095 | - | NZ_CP054020.1 | Thiomicrorhabdus xiamenensis |
14 | 2690124 | 2690396 | - | NZ_AP021889.1 | Thiosulfatimonas sediminis |
15 | 2342111 | 2342383 | - | NZ_CP040602.1 | Thiomicrorhabdus sediminis |
16 | 2414141 | 2414413 | - | NZ_AP018722.1 | Thiomicrorhabdus aquaedulcis |
17 | 3557012 | 3557308 | - | NZ_CP017415.1 | Acidihalobacter yilgarnenesis |
18 | 2203231 | 2203524 | + | NZ_CP012373.2 | Beggiatoa leptomitoformis |
19 | 1567906 | 1568199 | + | NZ_AP021884.1 | Sulfuriferula plumbiphila |
20 | 30167 | 30421 | + | NZ_CP026328.2 | Acidithiobacillus caldus |
21 | 52145 | 52399 | + | NZ_CP045571.1 | Acidithiobacillus thiooxidans ATCC 19377 |
22 | 1531681 | 1531935 | + | NZ_AP018795.1 | Acidithiobacillus ferridurans |
23 | 2891540 | 2891794 | - | NC_011761.1 | Acidithiobacillus ferrooxidans ATCC 23270 |
24 | 3126510 | 3126764 | - | NC_015942.1 | Acidithiobacillus ferrivorans SS3 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00006.27 | 1.0 | 24 | 1947.0 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
2 | PF02874.25 | 1.0 | 24 | 1947.0 | same-strand | ATP synthase alpha/beta family, beta-barrel domain |
3 | PF00231.21 | 0.96 | 23 | 2647 | same-strand | ATP synthase |
4 | PF00306.29 | 1.0 | 24 | 1090.0 | same-strand | ATP synthase alpha/beta chain, C terminal domain |
5 | PF00213.20 | 1.0 | 24 | 536.0 | same-strand | ATP synthase delta (OSCP) subunit |
6 | PF00430.20 | 1.0 | 24 | 52.0 | same-strand | ATP synthase B/B' CF(0) |
7 | PF00119.22 | 1.0 | 24 | 94.5 | same-strand | ATP synthase A chain |
8 | PF03899.17 | 1.0 | 24 | 954.0 | same-strand | ATP synthase I chain |
9 | PF02195.20 | 0.88 | 21 | 1770 | same-strand | ParB-like nuclease domain |
10 | PF17762.3 | 0.88 | 21 | 1770 | same-strand | HTH domain found in ParB protein |
11 | PF13614.8 | 0.83 | 20 | 2543.5 | same-strand | AAA domain |
12 | PF01656.25 | 0.83 | 20 | 2543.5 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |