Protein Information |
Information Type | Description |
---|---|
Protein name | Light-harvesting protein B-800/850 alpha chain (Antenna pigment protein alpha chain) (LH-2) |
NCBI Accession ID | M16777.1 |
Organism | Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) |
Left | 511 |
Right | 675 |
Strand | + |
Nucleotide Sequence | ATGACCAACGGCAAAATCTGGCTCGTGGTGAAACCGACCGTCGGCGTTCCGCTGTTCCTCAGCGCTGCCGTCATCGCCTCCGTCGTTATCCACGCTGCTGTGCTGACGACCACCACCTGGCTGCCCGCCTACTACCAAGGCTCGGCTGCGGTCGCGGCCGAGTAA |
Sequence | MTNGKIWLVVKPTVGVPLFLSAAVIASVVIHAAVLTTTTWLPAYYQGSAAVAAE |
Source of smORF | Swiss-Prot |
Function | Antenna complexes are light-harvesting systems, which transfer the excitation energy to the reaction centers. |
Pubmed ID | 3036782 1453956 10648776 |
Domain | CDD:395441 |
Functional Category | Metal-binding |
Uniprot ID | Q3J144 |
ORF Length (Amino Acid) | 54 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1948211 | 1948402 | + | NZ_CP015421.1 | Rhodovulum sulfidophilum |
2 | 1569116 | 1569295 | + | NZ_CP058907.1 | Rhodopseudomonas palustris |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00556.22 | 1.0 | 2 | 17.5 | same-strand | Antenna complex alpha/beta subunit |
2 | PF03209.17 | 1.0 | 2 | 172.5 | same-strand | PUCC protein |