Result : Q3J144
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Light-harvesting protein B-800/850 alpha chain (Antenna pigment protein alpha chain) (LH-2) |
| NCBI Accession ID | M16777.1 |
| Organism | Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) |
| Left | 511 |
| Right | 675 |
| Strand | + |
| Nucleotide Sequence | ATGACCAACGGCAAAATCTGGCTCGTGGTGAAACCGACCGTCGGCGTTCCGCTGTTCCTCAGCGCTGCCGTCATCGCCTCCGTCGTTATCCACGCTGCTGTGCTGACGACCACCACCTGGCTGCCCGCCTACTACCAAGGCTCGGCTGCGGTCGCGGCCGAGTAA |
| Sequence | MTNGKIWLVVKPTVGVPLFLSAAVIASVVIHAAVLTTTTWLPAYYQGSAAVAAE |
| Source of smORF | Swiss-Prot |
| Function | Antenna complexes are light-harvesting systems, which transfer the excitation energy to the reaction centers. |
| Pubmed ID | 3036782 1453956 10648776 |
| Domain | CDD:395441 |
| Functional Category | Metal-binding |
| Uniprot ID | Q3J144 |
| ORF Length (Amino Acid) | 54 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1948211 | 1948402 | + | NZ_CP015421.1 | Rhodovulum sulfidophilum |
| 2 | 1569116 | 1569295 | + | NZ_CP058907.1 | Rhodopseudomonas palustris |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP015421.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00556.22 | 1.0 | 2 | 17.5 | same-strand | Antenna complex alpha/beta subunit |
| 2 | PF03209.17 | 1.0 | 2 | 172.5 | same-strand | PUCC protein |
++ More..