Result : Q3IY62
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S20 |
| NCBI Accession ID | CP000143.2 |
| Organism | Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) |
| Left | 3109873 |
| Right | 3110151 |
| Strand | + |
| Nucleotide Sequence | ATGGCCAACTCGCCCCAGTCCAAGAAGCGTGCCCGCCAGGCCGAGGCCCGCGCCGCCGTTAACAAGGCCCGCCGGTCGCGGATCCGCACCTTCCTGCGCAAGGTCGAGGAAGCGATCGCCACGGGTGACGCGTCGGTTGCTGCCGCCGCCCTGAAGACCGCCCAGCCCGAGCTGGCGCGCGGTGTCACCAAGGGTGTGCTGCACAAGAACACCGTGGCCCGCAAGATGTCGCGCCTCGCGCACCGTGTGAAGGTGCTGTCGCAGCCCGCCGCAGCCTGA |
| Sequence | MANSPQSKKRARQAEARAAVNKARRSRIRTFLRKVEEAIATGDASVAAAALKTAQPELARGVTKGVLHKNTVARKMSRLAHRVKVLSQPAAA |
| Source of smORF | Swiss-Prot |
| Function | Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}. |
| Pubmed ID | |
| Domain | CDD:412349 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q3IY62 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 318
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3615412 | 3615678 | + | NZ_CP061202.1 | Rhodobacter capsulatus |
| 2 | 3543739 | 3544005 | + | NC_009952.1 | Dinoroseobacter shibae DFL 12 = DSM 16493 |
| 3 | 783545 | 783814 | + | NZ_CP012661.1 | Defluviimonas alba |
| 4 | 1851665 | 1851934 | + | NZ_CP020612.1 | Paracoccus contaminans |
| 5 | 1656738 | 1657010 | + | NZ_CP061498.1 | Roseicitreum antarcticum |
| 6 | 169977 | 170255 | + | NZ_CP035510.1 | Haematobacter massiliensis |
| 7 | 1219830 | 1220105 | + | NZ_CP039964.1 | Pseudorhodobacter turbinis |
| 8 | 2256373 | 2256636 | + | NZ_CP042261.1 | Qingshengfaniella alkalisoli |
| 9 | 3047243 | 3047512 | + | NZ_CP045201.1 | Pseudopuniceibacterium antarcticum |
| 10 | 3857928 | 3858191 | + | NZ_CP034348.1 | Roseovarius faecimaris |
| 11 | 2737421 | 2737684 | + | NZ_CP060436.1 | Pseudooceanicola algae |
| 12 | 3898708 | 3898974 | + | NZ_CP024899.1 | Rhodobaca barguzinensis |
| 13 | 310561 | 310827 | + | NZ_CP015421.1 | Rhodovulum sulfidophilum |
| 14 | 3910288 | 3910554 | + | NZ_CP019437.1 | Thioclava nitratireducens |
| 15 | 1113377 | 1113652 | + | NZ_CP030918.1 | Paracoccus suum |
| 16 | 3307983 | 3308249 | + | NZ_CP021404.1 | Pacificitalea manganoxidans |
| 17 | 4042916 | 4043182 | + | NZ_CP053562.1 | Thioclava electrotropha |
| 18 | 3890778 | 3891041 | + | NZ_CP054599.1 | Sulfitobacter pseudonitzschiae |
| 19 | 456631 | 456900 | + | NZ_CP030239.1 | Paracoccus mutanolyticus |
| 20 | 2429613 | 2429882 | - | NZ_CP012908.1 | Ketogulonicigenium vulgare |
| 21 | 2484185 | 2484448 | - | NZ_CP051181.1 | Thalassobius gelatinovorus |
| 22 | 4038817 | 4039080 | + | NZ_CP040818.1 | Paraoceanicella profunda |
| 23 | 2050953 | 2051225 | - | NZ_CP020470.1 | Rhodobacter blasticus |
| 24 | 4039970 | 4040233 | + | NZ_CP065915.1 | Pelagovum pacificum |
| 25 | 1318316 | 1318585 | - | NZ_CP045073.1 | Paracoccus kondratievae |
| 26 | 1664987 | 1665250 | - | NZ_CP012023.1 | Celeribacter marinus |
| 27 | 3726558 | 3726821 | + | NZ_CP010855.1 | Marinovum algicola DG 898 |
| 28 | 1396176 | 1396439 | + | NZ_CP014327.1 | Halocynthiibacter arcticus |
| 29 | 2360396 | 2360659 | + | NZ_CP027407.1 | Roseobacter denitrificans |
| 30 | 2429193 | 2429462 | + | NZ_CP034328.1 | Tabrizicola piscis |
| 31 | 3557931 | 3558194 | + | NZ_CP032125.1 | Profundibacter amoris |
| 32 | 5199564 | 5199827 | + | NC_020908.1 | Octadecabacter arcticus 238 |
| 33 | 4504540 | 4504803 | + | NC_015730.1 | Roseobacter litoralis Och 149 |
| 34 | 3171498 | 3171761 | - | NZ_CP041159.1 | Leisingera aquaemixtae |
| 35 | 3287519 | 3287782 | + | NZ_CP003984.1 | Planktomarina temperata RCA23 |
| 36 | 4350706 | 4350969 | + | NZ_CP034588.1 | Silicimonas algicola |
| 37 | 2024031 | 2024294 | - | NZ_CP049037.1 | Pseudohalocynthiibacter aestuariivivens |
| 38 | 3860905 | 3861168 | + | NZ_CP048788.1 | Roseobacter ponti |
| 39 | 2043526 | 2043795 | - | NZ_CP019937.1 | Ketogulonicigenium robustum |
| 40 | 4811885 | 4812148 | + | NC_020911.1 | Octadecabacter antarcticus 307 |
| 41 | 163518 | 163781 | + | NC_003911.12 | Ruegeria pomeroyi DSS-3 |
| 42 | 3706243 | 3706506 | + | NZ_CP021047.1 | Phaeobacter gallaeciensis |
| 43 | 4144579 | 4144842 | + | NC_023135.1 | Leisingera methylohalidivorans DSM 14336 |
| 44 | 1292805 | 1293071 | - | NZ_CP004372.1 | Roseibacterium elongatum DSM 19469 |
| 45 | 2700952 | 2701215 | + | NZ_CP022196.1 | Celeribacter ethanolicus |
| 46 | 3259905 | 3260168 | + | NZ_CP015230.1 | Epibacterium mobile F1926 |
| 47 | 4040843 | 4041106 | + | NZ_CP061205.1 | Kordiimonas pumila |
| 48 | 3652719 | 3652982 | + | NZ_CP016364.1 | Phaeobacter porticola |
| 49 | 3705569 | 3705832 | + | NZ_CP010650.1 | Phaeobacter inhibens |
| 50 | 4528033 | 4528296 | + | NZ_CP004393.1 | Celeribacter indicus |
| 51 | 3232414 | 3232677 | + | NZ_CP012160.1 | Octadecabacter temperatus |
| 52 | 4416313 | 4416576 | + | NZ_CP033219.1 | Parasedimentitalea marina |
| 53 | 3314406 | 3314672 | + | NZ_CP046908.1 | Stappia indica |
| 54 | 618395 | 618664 | - | NC_022041.1 | Paracoccus aminophilus JCM 7686 |
| 55 | 1715540 | 1715803 | + | NZ_CP015093.1 | Salipiger abyssi |
| 56 | 70244 | 70504 | + | NZ_CP037948.1 | Qipengyuania sediminis |
| 57 | 5868392 | 5868652 | + | NZ_CP030265.1 | Skermanella pratensis |
| 58 | 2818545 | 2818805 | + | NZ_AP019389.1 | Qipengyuania flava |
| 59 | 3439679 | 3439945 | + | NZ_CP030126.1 | Indioceanicola profundi |
| 60 | 3270595 | 3270864 | + | NZ_CP038439.1 | Paracoccus liaowanqingii |
| 61 | 2442949 | 2443218 | - | NZ_CP025430.1 | Paracoccus zhejiangensis |
| 62 | 2823769 | 2824029 | - | NZ_CP053921.1 | Erythrobacter mangrovi |
| 63 | 4014116 | 4014388 | + | NC_014664.1 | Rhodomicrobium vannielii ATCC 17100 |
| 64 | 2591419 | 2591679 | + | NZ_CP016545.1 | Paraurantiacibacter namhicola |
| 65 | 2805369 | 2805635 | + | NZ_CP053856.1 | Rhizobium pusense |
| 66 | 636092 | 636352 | + | NZ_CP022889.1 | Tsuneonella mangrovi |
| 67 | 1708937 | 1709200 | - | NZ_CP068983.1 | Paradevosia shaoguanensis |
| 68 | 2963452 | 2963712 | + | NZ_CP031357.1 | Erythrobacter aureus |
| 69 | 3514889 | 3515155 | - | NZ_CP042304.1 | Devosia ginsengisoli |
| 70 | 4646837 | 4647103 | + | NZ_HG938353.1 | Neorhizobium galegae bv. orientalis str. HAMBI 540 |
| 71 | 2440 | 2712 | - | NZ_CP044331.1 | Methylocystis parvus |
| 72 | 4004767 | 4005030 | + | NZ_CP035765.1 | Sphingomonas paucimobilis |
| 73 | 863454 | 863714 | + | NZ_CP012401.1 | Azospirillum thiophilum |
| 74 | 573733 | 574008 | + | NZ_CP032694.1 | Rhizobium jaguaris |
| 75 | 4429763 | 4430026 | + | NZ_CP041690.1 | Youhaiella tibetensis |
| 76 | 1810775 | 1811038 | + | NZ_CP022745.1 | Sphingobium xenophagum |
| 77 | 2921314 | 2921580 | + | NZ_CP061003.1 | Agrobacterium tumefaciens |
| 78 | 1872458 | 1872724 | - | NZ_CP048632.1 | Rhizobium oryzihabitans |
| 79 | 3183682 | 3183948 | - | NZ_CP059896.1 | Ciceribacter thiooxidans |
| 80 | 4647969 | 4648235 | + | NC_015259.1 | Polymorphum gilvum SL003B-26A1 |
| 81 | 1084064 | 1084333 | - | NZ_LN832559.1 | Paracoccus aminovorans |
| 82 | 2943679 | 2943942 | - | NZ_CP018221.1 | Tardibacter chloracetimidivorans |
| 83 | 402388 | 402666 | + | NZ_CP013532.1 | Rhizobium phaseoli |
| 84 | 359787 | 360065 | + | NZ_CP071612.1 | Rhizobium bangladeshense |
| 85 | 981 | 1241 | - | NZ_CP029353.1 | Azospirillum thermophilum |
| 86 | 2584201 | 2584467 | + | NZ_CP022604.1 | [Ochrobactrum] quorumnocens |
| 87 | 2655629 | 2655889 | + | NZ_CP029829.1 | Azospirillum ramasamyi |
| 88 | 2950235 | 2950501 | + | NZ_CP054836.1 | Oricola thermophila |
| 89 | 3137596 | 3137862 | + | NZ_CP017940.1 | Phyllobacterium zundukense |
| 90 | 372984 | 373262 | + | NZ_CP013500.1 | Rhizobium esperanzae |
| 91 | 357057 | 357335 | + | NZ_CP020906.1 | Rhizobium etli |
| 92 | 91400 | 91660 | - | NZ_CP054619.1 | Azospirillum oryzae |
| 93 | 450709 | 450984 | + | NC_020059.1 | Rhizobium tropici CIAT 899 |
| 94 | 1706764 | 1707024 | + | NZ_CP011452.2 | Croceibacterium atlanticum |
| 95 | 143411 | 143677 | + | NC_014932.1 | Bartonella clarridgeiae 73 |
| 96 | 795334 | 795597 | - | NZ_CP045434.1 | Sphingomonas ginsengisoli An et al. 2013 |
| 97 | 327581 | 327850 | + | NZ_CP040517.1 | Luteithermobacter gelatinilyticus |
| 98 | 406571 | 406849 | + | NZ_CP071604.1 | Rhizobium binae |
| 99 | 2353070 | 2353333 | + | NZ_CP025611.1 | Niveispirillum cyanobacteriorum |
| 100 | 2196545 | 2196823 | + | NZ_CP071454.1 | Rhizobium lentis |
| 101 | 1750603 | 1750866 | - | NZ_CP060718.1 | Sphingomonas lutea |
| 102 | 4187715 | 4187987 | + | NZ_CP041025.1 | Paremcibacter congregatus |
| 103 | 3965455 | 3965733 | - | NZ_CP054027.1 | Rhizobium hidalgonense |
| 104 | 4568162 | 4568440 | + | NZ_CP034998.1 | Rhizobium acidisoli |
| 105 | 2290736 | 2291014 | - | NZ_CP054021.1 | Rhizobium indicum |
| 106 | 627942 | 628208 | - | NZ_CP018171.1 | Mesorhizobium oceanicum |
| 107 | 446751 | 447029 | + | NZ_CP071678.1 | Rhizobium ruizarguesonis |
| 108 | 612992 | 613258 | - | NC_014217.1 | Starkeya novella DSM 506 |
| 109 | 446301 | 446567 | + | NZ_CP031843.2 | Bartonella kosoyi |
| 110 | 155722 | 155988 | + | NC_010161.1 | Bartonella tribocorum CIP 105476 |
| 111 | 2732132 | 2732398 | + | NZ_CP064063.1 | Brucella anthropi |
| 112 | 7770153 | 7770419 | - | NC_011894.1 | Methylobacterium nodulans ORS 2060 |
| 113 | 736927 | 737193 | - | NZ_CP015064.1 | Mesorhizobium ciceri biovar biserrulae |
| 114 | 845310 | 845570 | - | NZ_CP011310.1 | Aurantiacibacter atlanticus |
| 115 | 2243711 | 2243977 | - | NZ_CP010803.1 | Martelella endophytica |
| 116 | 1372765 | 1373028 | - | NC_006526.2 | Zymomonas mobilis subsp. mobilis ZM4 = ATCC 31821 |
| 117 | 371870 | 372136 | + | NZ_LR134529.1 | Bartonella vinsonii |
| 118 | 1679177 | 1679440 | + | NZ_CP060780.1 | Sphingomonas daechungensis |
| 119 | 5831670 | 5831936 | + | NZ_AP019700.1 | Stella humosa |
| 120 | 1118771 | 1119031 | + | NZ_CP024920.1 | Qipengyuania seohaensis |
| 121 | 2092450 | 2092719 | - | NZ_CP022048.2 | Brevundimonas vesicularis |
| 122 | 2474663 | 2474932 | - | NZ_CP025583.1 | Paracoccus jeotgali |
| 123 | 1224178 | 1224438 | - | NZ_CP060717.1 | Sphingomonas rhizophila |
| 124 | 3881995 | 3882264 | + | NC_011144.1 | Phenylobacterium zucineum HLK1 |
| 125 | 2105495 | 2105761 | + | NC_010103.1 | Brucella canis ATCC 23365 |
| 126 | 2107322 | 2107588 | + | NC_004310.3 | Brucella suis 1330 |
| 127 | 2110897 | 2111163 | + | NC_009505.1 | Brucella ovis ATCC 25840 |
| 128 | 2116578 | 2116844 | + | NC_013119.1 | Brucella microti CCM 4915 |
| 129 | 2003557 | 2003823 | - | NC_003317.1 | Brucella melitensis bv. 1 str. 16M |
| 130 | 2004772 | 2005038 | - | NC_022905.1 | Brucella ceti TE10759-12 |
| 131 | 2120887 | 2121153 | + | NC_007618.1 | Brucella abortus 2308 |
| 132 | 586256 | 586522 | - | NZ_LT605585.1 | Brucella inopinata |
| 133 | 2326960 | 2327223 | + | NZ_CP023449.1 | Rhizorhabdus dicambivorans |
| 134 | 2284284 | 2284562 | + | NZ_CP044117.1 | Roseomonas mucosa |
| 135 | 398139 | 398405 | + | NC_020528.1 | Sinorhizobium meliloti 2011 |
| 136 | 2156597 | 2156863 | + | NZ_CP031844.2 | Bartonella krasnovii |
| 137 | 1040107 | 1040373 | + | NC_017059.1 | Pararhodospirillum photometricum DSM 122 |
| 138 | 1643094 | 1643360 | - | NZ_CP015318.1 | Mesorhizobium amorphae CCNWGS0123 |
| 139 | 2017473 | 2017739 | + | NZ_LR134527.1 | Bartonella elizabethae |
| 140 | 371268 | 371531 | - | NZ_CP041659.1 | Sphingomonas xanthus |
| 141 | 3344579 | 3344842 | + | NC_008048.1 | Sphingopyxis alaskensis RB2256 |
| 142 | 1411866 | 1412129 | - | NZ_CP060782.1 | Sphingomonas sediminicola |
| 143 | 232179 | 232439 | - | NZ_CP012669.1 | Altererythrobacter epoxidivorans |
| 144 | 371368 | 371634 | + | NZ_CP013107.1 | Sinorhizobium americanum |
| 145 | 3009235 | 3009495 | + | NZ_CP016591.1 | Tsuneonella dongtanensis |
| 146 | 1071931 | 1072191 | + | NZ_CP042306.1 | Sphingomonas panacisoli |
| 147 | 693664 | 693930 | - | NZ_CP036532.1 | Roseitalea porphyridii |
| 148 | 278366 | 278632 | + | NZ_LR723670.1 | Pseudorhizobium flavum |
| 149 | 4239208 | 4239474 | + | NZ_FO082820.1 | Pseudorhizobium banfieldiae |
| 150 | 152899 | 153165 | + | NC_012846.1 | Bartonella grahamii as4aup |
| 151 | 1966924 | 1967193 | - | NZ_CP060244.1 | Entomobacter blattae |
| 152 | 2955570 | 2955833 | - | NZ_CP053015.1 | Sphingomonas lacunae |
| 153 | 3822096 | 3822362 | + | NZ_CP045423.1 | Microvirga thermotolerans |
| 154 | 4654814 | 4655089 | + | NZ_CP027850.1 | Caulobacter segnis |
| 155 | 4992816 | 4993079 | + | NZ_CP009122.1 | Sphingopyxis fribergensis |
| 156 | 1086166 | 1086432 | + | NZ_CP058235.1 | Bartonella alsatica |
| 157 | 473282 | 473548 | + | NZ_CP041238.1 | Ensifer mexicanus |
| 158 | 2802753 | 2803016 | - | NZ_CP022110.1 | Nitrospirillum amazonense CBAmc |
| 159 | 5731725 | 5732000 | + | NZ_CP048815.1 | Caulobacter rhizosphaerae |
| 160 | 3369243 | 3369509 | - | NZ_CP048630.1 | Ancylobacter pratisalsi |
| 161 | 1238204 | 1238479 | - | NZ_CP026100.1 | Caulobacter flavus |
| 162 | 3766575 | 3766838 | + | NZ_AP017655.1 | Sphingobium cloacae |
| 163 | 143308 | 143574 | + | NZ_AP019773.1 | Bartonella quintana |
| 164 | 4960 | 5235 | + | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 165 | 137335 | 137601 | + | NC_020300.1 | Bartonella australis Aust/NH1 |
| 166 | 6200045 | 6200311 | + | NC_019973.1 | Mesorhizobium australicum WSM2073 |
| 167 | 179 | 442 | + | NC_009719.1 | Parvibaculum lavamentivorans DS-1 |
| 168 | 612692 | 612958 | + | NZ_CP010401.1 | Bartonella ancashensis |
| 169 | 3652681 | 3652944 | + | NZ_CP023705.1 | Sphingomonas melonis |
| 170 | 1515575 | 1515850 | - | NZ_CP029553.1 | Methylobacterium terrae |
| 171 | 1140721 | 1140987 | - | NC_009937.1 | Azorhizobium caulinodans ORS 571 |
| 172 | 5892869 | 5893129 | + | NZ_CP042906.1 | Hypericibacter terrae |
| 173 | 2884579 | 2884839 | + | NZ_CP011805.1 | Pelagerythrobacter marensis |
| 174 | 1326576 | 1326842 | - | NC_008783.1 | Bartonella bacilliformis KC583 |
| 175 | 131107 | 131367 | - | NZ_CP031555.1 | Thalassospira indica |
| 176 | 1186836 | 1187102 | + | NZ_CP017147.1 | Bosea vaviloviae |
| 177 | 5381839 | 5382102 | + | NC_009511.1 | Sphingomonas wittichii RW1 |
| 178 | 2559181 | 2559444 | + | NZ_CP014168.1 | Sphingomonas panacis |
| 179 | 4575980 | 4576240 | + | NZ_CP004388.1 | Thalassospira xiamenensis M-5 = DSM 17429 |
| 180 | 6933502 | 6933768 | + | NZ_CP033507.1 | Mesorhizobium jarvisii |
| 181 | 4529653 | 4529913 | + | NZ_CP024199.1 | Thalassospira marina |
| 182 | 4550731 | 4551003 | + | NZ_CP046052.1 | Methylocystis heyeri |
| 183 | 3105233 | 3105502 | + | NZ_CP036404.1 | Komagataeibacter saccharivorans |
| 184 | 3382602 | 3382871 | + | NZ_LR588407.1 | Brevundimonas vancanneytii |
| 185 | 4304617 | 4304883 | + | NC_011666.1 | Methylocella silvestris BL2 |
| 186 | 6601096 | 6601362 | + | NZ_CP033361.1 | Mesorhizobium erdmanii |
| 187 | 4479798 | 4480064 | - | NC_002678.2 | Mesorhizobium japonicum MAFF 303099 |
| 188 | 817601 | 817867 | - | NZ_CP049241.1 | Rhizobium pseudoryzae |
| 189 | 3056602 | 3056871 | + | NZ_CP019875.1 | Komagataeibacter nataicola |
| 190 | 1545535 | 1545798 | - | NZ_CP020083.1 | Blastomonas fulva |
| 191 | 3898906 | 3899172 | - | NZ_CP050296.1 | Mesorhizobium huakuii |
| 192 | 4355464 | 4355730 | + | NZ_CP032509.1 | Georhizobium profundi |
| 193 | 5394784 | 5395050 | + | NZ_CP039546.1 | Methylorubrum populi |
| 194 | 3863864 | 3864139 | + | NZ_CP013002.1 | Caulobacter henricii |
| 195 | 5330050 | 5330316 | + | NZ_CP015367.1 | Methylobacterium phyllosphaerae |
| 196 | 2238666 | 2238932 | - | NZ_CP043538.1 | Methylobacterium mesophilicum SR1.6/6 |
| 197 | 6883996 | 6884262 | + | NC_015675.1 | Mesorhizobium opportunistum WSM2075 |
| 198 | 3444786 | 3445055 | + | NC_014375.1 | Brevundimonas subvibrioides ATCC 15264 |
| 199 | 772267 | 772527 | - | NZ_CP042345.1 | Novosphingobium ginsenosidimutans |
| 200 | 6205234 | 6205497 | + | NZ_CP006644.1 | Sphingomonas sanxanigenens DSM 19645 = NX02 |
| 201 | 3066803 | 3067066 | - | NZ_CP010836.1 | Sphingomonas hengshuiensis |
| 202 | 3748933 | 3749205 | + | NC_015186.1 | Acidiphilium multivorum AIU301 |
| 203 | 46677 | 46946 | - | NZ_CP025086.1 | Methylovirgula ligni |
| 204 | 2722780 | 2723043 | - | NZ_CP061038.1 | Sphingomonas alpina |
| 205 | 703922 | 704185 | - | NC_007798.1 | Neorickettsia sennetsu str. Miyayama |
| 206 | 1097190 | 1097459 | + | NZ_CP050139.1 | Komagataeibacter rhaeticus |
| 207 | 194352 | 194618 | - | NZ_CP021330.1 | Maritalea myrionectae |
| 208 | 3820928 | 3821200 | + | NZ_CP072611.1 | Aureimonas populi |
| 209 | 4352015 | 4352281 | + | NC_017584.1 | Rhodospirillum rubrum F11 |
| 210 | 1968675 | 1968947 | + | NZ_CP053708.1 | Lichenicola cladoniae |
| 211 | 15 | 281 | + | NC_010505.1 | Methylobacterium radiotolerans JCM 2831 |
| 212 | 1195448 | 1195717 | - | NZ_CP042808.1 | Acetobacter oryzoeni |
| 213 | 1976 | 2245 | - | NC_021991.1 | Acetobacter pasteurianus 386B |
| 214 | 851534 | 851803 | - | NZ_CP015164.1 | Acetobacter ascendens |
| 215 | 1325514 | 1325783 | - | NZ_CP022374.1 | Acetobacter oryzifermentans |
| 216 | 409165 | 409428 | + | NZ_CP009571.1 | Sphingomonas taxi |
| 217 | 721823 | 722086 | - | NC_013009.1 | Neorickettsia risticii str. Illinois |
| 218 | 2340504 | 2340773 | + | NZ_CP071057.1 | Marinicauda algicola |
| 219 | 3136309 | 3136578 | + | NC_016027.1 | Komagataeibacter medellinensis NBRC 3288 |
| 220 | 3961247 | 3961513 | + | NZ_CP053086.1 | Pelagibacterium halotolerans |
| 221 | 3680337 | 3680606 | + | NZ_LN606600.1 | Acetobacter senegalensis |
| 222 | 2681383 | 2681652 | - | NZ_CP062147.1 | Komagataeibacter hansenii |
| 223 | 183999 | 184268 | + | NZ_CP003182.2 | Granulibacter bethesdensis CGDNIH4 |
| 224 | 3560825 | 3561085 | + | NC_007794.1 | Novosphingobium aromaticivorans DSM 12444 |
| 225 | 280069 | 280347 | + | NZ_CP029550.1 | Methylobacterium durans |
| 226 | 984366 | 984629 | - | NZ_CP051131.1 | Parasphingopyxis algicola |
| 227 | 2476165 | 2476431 | + | NZ_CP016616.1 | Microvirga ossetica |
| 228 | 705017 | 705280 | - | NZ_CP047224.1 | Neorickettsia findlayensis |
| 229 | 717343 | 717606 | - | NZ_CP007481.1 | Neorickettsia helminthoeca str. Oregon |
| 230 | 3339232 | 3339495 | - | NC_012982.1 | Hirschia baltica ATCC 49814 |
| 231 | 2774830 | 2775090 | - | NZ_CP009291.1 | Novosphingobium pentaromativorans US6-1 |
| 232 | 3918135 | 3918404 | + | NC_017956.1 | Tistrella mobilis KA081020-065 |
| 233 | 5863987 | 5864247 | + | NZ_CP042582.1 | Hypericibacter adhaerens |
| 234 | 3906739 | 3907008 | + | NZ_CP029176.1 | Acidibrevibacterium fodinaquatile |
| 235 | 834893 | 835156 | + | NC_014006.1 | Sphingobium japonicum UT26S |
| 236 | 2162619 | 2162888 | + | NZ_CP038141.1 | Swingsia samuiensis |
| 237 | 1316404 | 1316667 | - | NZ_CP020538.1 | Sphingobium herbicidovorans |
| 238 | 371808 | 372086 | + | NZ_CP006877.1 | Rhizobium gallicum bv. gallicum R602sp |
| 239 | 542436 | 542696 | - | NZ_CP017057.1 | Erythrobacter litoralis |
| 240 | 3459083 | 3459349 | - | NZ_CP039690.1 | Phreatobacter stygius |
| 241 | 3388646 | 3388909 | + | NZ_CP060035.1 | Sphingobium fuliginis |
| 242 | 2673283 | 2673543 | + | NZ_CP015963.1 | Altererythrobacter ishigakiensis |
| 243 | 506407 | 506667 | + | NZ_CP016033.1 | Erythrobacter neustonensis |
| 244 | 3040725 | 3040991 | + | NZ_CP027668.1 | Phreatobacter cathodiphilus |
| 245 | 5174642 | 5174905 | + | NZ_CP009429.1 | Sphingopyxis macrogoltabida |
| 246 | 5325818 | 5326084 | + | NZ_LT960614.1 | Hartmannibacter diazotrophicus |
| 247 | 698543 | 698809 | - | NZ_AP014648.1 | Methyloceanibacter caenitepidi |
| 248 | 145768 | 146034 | - | NZ_CP019044.1 | Salaquimonas pukyongi |
| 249 | 196460 | 196723 | - | NC_022997.1 | Hyphomicrobium nitrativorans NL23 |
| 250 | 629671 | 629937 | + | NZ_CP018911.1 | Glycocaulis alkaliphilus |
| 251 | 4364983 | 4365255 | + | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 252 | 366815 | 367075 | - | NZ_CP060052.1 | Croceicoccus marinus |
| 253 | 8 | 271 | + | NC_010581.1 | Beijerinckia indica subsp. indica ATCC 9039 |
| 254 | 2827882 | 2828151 | + | NZ_CP029479.1 | Phenylobacterium parvum |
| 255 | 683072 | 683344 | + | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
| 256 | 646996 | 647262 | - | NZ_CP049250.1 | Rhizobium rhizoryzae |
| 257 | 2843957 | 2844226 | + | NZ_CP068419.1 | Gluconobacter sphaericus |
| 258 | 1562195 | 1562464 | + | NZ_CP014689.1 | Gluconobacter albidus |
| 259 | 185155 | 185424 | - | NZ_CP024201.1 | Caulobacter mirabilis |
| 260 | 2881944 | 2882213 | + | NZ_CP004373.1 | Gluconobacter oxydans DSM 3504 |
| 261 | 3237411 | 3237680 | + | NZ_CP043043.1 | Gluconobacter thailandicus |
| 262 | 270265 | 270531 | + | NZ_AP014946.1 | Variibacter gotjawalensis |
| 263 | 4670396 | 4670662 | + | NZ_CP020330.1 | Martelella mediterranea DSM 17316 |
| 264 | 598808 | 599074 | + | NZ_CP012946.1 | Blastochloris viridis |
| 265 | 2345633 | 2345893 | - | NZ_CP021377.1 | Oceanisphaera profunda |
| 266 | 4137304 | 4137573 | + | NC_018691.1 | Alcanivorax dieselolei B5 |
| 267 | 1699818 | 1700078 | + | NZ_CP021376.1 | Oceanisphaera avium |
| 268 | 1294810 | 1295076 | - | NC_007912.1 | Saccharophagus degradans 2-40 |
| 269 | 215313 | 215579 | - | NC_014414.1 | Parvularcula bermudensis HTCC2503 |
| 270 | 1699174 | 1699440 | + | NZ_CP048711.1 | Kineobactrum salinum |
| 271 | 3689061 | 3689327 | + | NZ_CP034909.1 | Ensifer alkalisoli |
| 272 | 933558 | 933830 | + | NZ_CP014525.1 | Haematospirillum jordaniae |
| 273 | 3671082 | 3671348 | + | NZ_CP023067.1 | Ensifer sojae CCBAU 05684 |
| 274 | 2404850 | 2405125 | - | NZ_CP030840.1 | Acidisarcina polymorpha |
| 275 | 4197341 | 4197607 | + | NZ_CP029451.1 | Sinorhizobium fredii CCBAU 25509 |
| 276 | 660501 | 660761 | - | NZ_AP018724.1 | Sulfurivermis fontis |
| 277 | 2587722 | 2587988 | + | NC_014816.1 | Asticcacaulis excentricus CB 48 |
| 278 | 3638132 | 3638398 | + | NC_014313.1 | Hyphomicrobium denitrificans ATCC 51888 |
| 279 | 1108644 | 1108913 | - | NZ_CP014681.1 | Kozakia baliensis |
| 280 | 3864103 | 3864381 | + | NZ_CP047045.1 | Terricaulis silvestris |
| 281 | 3538956 | 3539219 | - | NZ_CP052766.1 | Alteromonas pelagimontana |
| 282 | 2243032 | 2243292 | - | NZ_CP041660.1 | Catenovulum sediminis |
| 283 | 2476680 | 2476949 | + | NZ_CP032485.1 | Neokomagataea tanensis |
| 284 | 2518358 | 2518618 | - | NZ_CP034179.1 | Caenibius tardaugens NBRC 16725 |
| 285 | 677392 | 677661 | - | NZ_CP004387.1 | Alcanivorax pacificus W11-5 |
| 286 | 3584782 | 3585054 | + | NZ_CP019948.1 | Methylocystis bryophila |
| 287 | 236418 | 236687 | + | NZ_CP021781.1 | Francisella adeliensis |
| 288 | 3070690 | 3070953 | + | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 289 | 850107 | 850367 | - | NC_014541.1 | Ferrimonas balearica DSM 9799 |
| 290 | 2367584 | 2367847 | + | NZ_CP029347.1 | Saliniradius amylolyticus |
| 291 | 2196305 | 2196565 | + | NZ_AP018685.1 | Vibrio rumoiensis |
| 292 | 2983972 | 2984232 | + | NZ_CP031769.1 | Salinimonas sediminis |
| 293 | 2329948 | 2330214 | - | NZ_CP019343.1 | Oceanicoccus sagamiensis |
| 294 | 1332308 | 1332577 | + | NZ_AP014690.1 | Asaia bogorensis NBRC 16594 |
| 295 | 398150 | 398419 | + | NC_016026.1 | Micavibrio aeruginosavorus ARL-13 |
| 296 | 2522263 | 2522526 | + | NZ_CP041636.1 | Ferrovibrio terrae |
| 297 | 1419732 | 1419992 | - | NZ_CP036536.1 | Salinimonas lutimaris |
| 298 | 965730 | 965993 | - | NC_015554.1 | Alteromonas naphthalenivorans |
| 299 | 768131 | 768397 | - | NZ_CP051183.1 | Bermanella marisrubri |
| 300 | 3444647 | 3444913 | + | NZ_CP036422.1 | Halioglobus maricola |
| 301 | 1204810 | 1205070 | - | NC_003910.7 | Colwellia psychrerythraea 34H |
| 302 | 3138214 | 3138477 | + | NZ_CP014322.1 | Alteromonas addita |
| 303 | 495692 | 495958 | - | NC_008260.1 | Alcanivorax borkumensis SK2 |
| 304 | 3595404 | 3595670 | + | NZ_AP014545.1 | Amphritea japonica ATCC BAA-1530 |
| 305 | 2720046 | 2720306 | + | NZ_CP039700.1 | Vibrio cyclitrophicus |
| 306 | 86494 | 86754 | - | NZ_CP051180.1 | Ferrimonas lipolytica |
| 307 | 581465 | 581725 | - | NZ_CP012621.1 | Zobellella denitrificans |
| 308 | 1383651 | 1383914 | + | NC_021291.1 | Spiribacter salinus M19-40 |
| 309 | 636120 | 636383 | - | NZ_LR134376.1 | Aeromonas encheleia |
| 310 | 616485 | 616745 | - | NZ_CP022741.1 | Vibrio qinghaiensis |
| 311 | 495228 | 495488 | - | NZ_AP018689.1 | Vibrio aphrogenes |
| 312 | 2829795 | 2830058 | + | NZ_CP046670.1 | Alteromonas mediterranea |
| 313 | 2820619 | 2820882 | + | NZ_CP008849.1 | Alteromonas australica |
| 314 | 3241217 | 3241480 | + | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 315 | 3349466 | 3349729 | + | NZ_CP040449.1 | Aeromonas simiae |
| 316 | 862330 | 862596 | + | NZ_AP018907.1 | Blastochloris tepida |
| 317 | 1196327 | 1196590 | + | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 318 | 2889537 | 2889806 | - | NZ_CP016022.1 | Ralstonia insidiosa |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP061202.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01149.26 | 0.69 | 218 | 989.0 | same-strand | Formamidopyrimidine-DNA glycosylase N-terminal domain |
| 2 | PF06831.16 | 0.69 | 218 | 989.0 | same-strand | Formamidopyrimidine-DNA glycosylase H2TH domain |
++ More..