Result : A7Z5W9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cell cycle protein GpsB (Guiding PBP1-shuttling protein) |
| NCBI Accession ID | CP000560.2 |
| Organism | Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42) (Bacillus amyloliquefaciens subsp. plantarum) |
| Left | 2137005 |
| Right | 2137304 |
| Strand | - |
| Nucleotide Sequence | ATGCTTGCTGATAAAGTAAAGCTTTCTGCGAAAGACATTTTGGAAAAAGAATTTAAAACAGGCGTTAGAGGTTACAGACAAGAAGACGTTGACAAATTTTTAGATATGATTATTAAGGATTATGAAACCTTTCATCAAGAAATTGAAGAATTGCAGCAAGAAAATCTGCAGCTGAAAAAACAGCTTGAAGAAGCAAGCAAAAAACAGCCGGTGCAGTCCAATACGACCAACTTTGACATTCTGAAAAGGCTGTCCAACCTTGAGAAACATGTATTCGGCAGCAAACTTTATGACGAATAG |
| Sequence | MLADKVKLSAKDILEKEFKTGVRGYRQEDVDKFLDMIIKDYETFHQEIEELQQENLQLKKQLEEASKKQPVQSNTTNFDILKRLSNLEKHVFGSKLYDE |
| Source of smORF | Swiss-Prot |
| Function | Divisome component that associates with the complex late in its assembly, after the Z-ring is formed, and is dependent on DivIC and PBP2B for its recruitment to the divisome. Together with EzrA, is a key component of the system that regulates PBP1 localization during cell cycle progression. Its main role could be the removal of PBP1 from the cell pole after pole maturation is completed. Also contributes to the recruitment of PBP1 to the division complex. Not essential for septum formation. {ECO:0000255|HAMAP-Rule:MF_02011}. |
| Pubmed ID | 17704766 |
| Domain | CDD:357139 |
| Functional Category | Others |
| Uniprot ID | A7Z5W9 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 111
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1783938 | 1784237 | + | NZ_CP011937.1 | Bacillus velezensis |
| 2 | 2215729 | 2216028 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 3 | 2129703 | 2129999 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 4 | 3924570 | 3924866 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 5 | 2287395 | 2287691 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 2203903 | 2204199 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 7 | 2201056 | 2201352 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 8 | 2140910 | 2141206 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 9 | 2331779 | 2332075 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 10 | 2302397 | 2302693 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 2404595 | 2404891 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 2511224 | 2511520 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 13 | 3350631 | 3350936 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 14 | 2030283 | 2030588 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 15 | 3258280 | 3258585 | + | NZ_CP043404.1 | Bacillus safensis |
| 16 | 1647033 | 1647332 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 17 | 3139729 | 3140031 | - | NZ_CP053989.1 | Niallia circulans |
| 18 | 3513248 | 3513547 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 19 | 3064804 | 3065106 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 20 | 560347 | 560649 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 21 | 3096461 | 3096760 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 22 | 1987173 | 1987472 | + | NZ_LS483476.1 | Lederbergia lentus |
| 23 | 3761357 | 3761665 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 24 | 1462180 | 1462476 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 25 | 1864052 | 1864354 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 26 | 3688309 | 3688611 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 27 | 4725099 | 4725410 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 28 | 1760787 | 1761083 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 29 | 2081760 | 2082059 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 30 | 444286 | 444597 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 31 | 1407999 | 1408331 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 32 | 2005618 | 2005956 | - | NZ_CP012024.1 | Bacillus smithii |
| 33 | 4344892 | 4345200 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 34 | 1379062 | 1379397 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 35 | 1487683 | 1488018 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 36 | 3597475 | 3597810 | - | NZ_CP040336.1 | Bacillus luti |
| 37 | 1537709 | 1538044 | + | NC_011725.1 | Bacillus cereus B4264 |
| 38 | 1488749 | 1489087 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 39 | 1580889 | 1581185 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 40 | 758024 | 758320 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 41 | 2362887 | 2363183 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 42 | 1059510 | 1059806 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 43 | 1505133 | 1505471 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 44 | 1803173 | 1803469 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 45 | 2273910 | 2274218 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 46 | 1518138 | 1518434 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 47 | 2890969 | 2891265 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 48 | 1942017 | 1942313 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 49 | 2018526 | 2018822 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 50 | 951213 | 951548 | + | NZ_LR134483.1 | Listeria grayi |
| 51 | 1937487 | 1937783 | - | NZ_LT906444.1 | Listeria welshimeri |
| 52 | 1453143 | 1453448 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 53 | 1962225 | 1962521 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 54 | 1847411 | 1847713 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 55 | 1720782 | 1721069 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 56 | 1924177 | 1924473 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 57 | 905104 | 905406 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 58 | 3135921 | 3136196 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 59 | 2760114 | 2760398 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 60 | 1907514 | 1907831 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 61 | 1789106 | 1789399 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 62 | 1811374 | 1811667 | - | NZ_CP016538.2 | Planococcus maritimus |
| 63 | 1817196 | 1817489 | - | NZ_CP059540.1 | Planococcus maritimus |
| 64 | 1732188 | 1732463 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 65 | 2933720 | 2933995 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 66 | 2051694 | 2052008 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 67 | 1565412 | 1565705 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 68 | 1492865 | 1493155 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 69 | 2341472 | 2341774 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 70 | 3104743 | 3105045 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 71 | 1934236 | 1934529 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 72 | 1988405 | 1988698 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 73 | 3661079 | 3661393 | + | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 74 | 2251827 | 2252117 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 75 | 3182846 | 3183139 | + | NZ_CP013661.2 | Planococcus kocurii |
| 76 | 2029050 | 2029343 | - | NZ_CP019401.1 | Planococcus faecalis |
| 77 | 1930127 | 1930420 | - | NZ_CP016540.2 | Planococcus versutus |
| 78 | 1603401 | 1603649 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 79 | 2198487 | 2198750 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 80 | 1823112 | 1823411 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 81 | 1789731 | 1790051 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 82 | 2783688 | 2784038 | + | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 83 | 1842516 | 1842830 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 84 | 1808574 | 1808837 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 85 | 46917 | 47213 | - | NZ_CP049889.1 | Jeotgalibaca porci |
| 86 | 1315740 | 1316018 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 87 | 2042492 | 2042773 | - | NZ_CP029797.1 | Paraliobacillus zengyii |
| 88 | 2159589 | 2159903 | + | NZ_CP023643.1 | Brochothrix thermosphacta |
| 89 | 2396943 | 2397269 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 90 | 1803549 | 1803797 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 91 | 3820938 | 3821246 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 92 | 2228535 | 2228843 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 93 | 1634838 | 1635149 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 94 | 2268996 | 2269289 | + | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 95 | 788087 | 788371 | + | NZ_CP019981.1 | Pediococcus inopinatus |
| 96 | 2199963 | 2200271 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 97 | 908414 | 908761 | + | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 98 | 1268987 | 1269322 | + | NZ_CP011361.2 | Salimicrobium jeotgali |
| 99 | 2060966 | 2061280 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 100 | 3272103 | 3272402 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 101 | 1425977 | 1426321 | - | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 102 | 1436657 | 1436998 | - | NC_014334.2 | Lacticaseibacillus paracasei |
| 103 | 1655116 | 1655388 | - | NZ_CP016843.1 | Carnobacterium divergens |
| 104 | 1383663 | 1384007 | - | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 105 | 1975945 | 1976229 | + | NZ_CP012294.1 | Pediococcus damnosus |
| 106 | 2847697 | 2847993 | - | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 107 | 1261837 | 1262106 | - | NZ_CP010450.1 | Streptococcus pyogenes |
| 108 | 1548935 | 1549264 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 109 | 1547183 | 1547512 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 110 | 785313 | 785639 | + | NZ_CP019573.1 | Abyssicoccus albus |
| 111 | 396874 | 397146 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 112 | 335729 | 336067 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP011937.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06908.13 | 0.66 | 73 | 87 | same-strand | YspA SLOG family |
| 2 | PF01170.20 | 0.97 | 108 | 616 | same-strand | Putative RNA methylase family UPF0020 |
| 3 | PF02926.19 | 0.84 | 93 | 625.5 | same-strand | THUMP domain |
++ More..