Result : Q3IJT8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein SlyX homolog |
| NCBI Accession ID | CR954246.1 |
| Organism | Pseudoalteromonas translucida (strain TAC 125) |
| Left | 3073021 |
| Right | 3073236 |
| Strand | + |
| Nucleotide Sequence | ATGAACACAATTGAACATCGCTTAATGGAACTTGAGGCCAAAGTGGCTTTTCAAGACGAAACAATTGATATTTTAAATGACGAAATAAAAGTTCACCAGCAGCTGTTGGCAAAAATGAAACGCCAAACAGAGCTACTGGCTGAAAAAATTAAAGAATCGCAGTCATCATCATCGATGATGTCAAACGAACCTGAGCCACCGCCGCCGCATTATTAA |
| Sequence | MNTIEHRLMELEAKVAFQDETIDILNDEIKVHQQLLAKMKRQTELLAEKIKESQSSSSMMSNEPEPPPPHY |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01090. Profile Description: SlyX. hypothetical protein; Provisional |
| Pubmed ID | 16169927 |
| Domain | CDD:412736 |
| Functional Category | Others |
| Uniprot ID | Q3IJT8 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 21
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3073021 | 3073236 | + | NC_007481.1 | Pseudoalteromonas translucida |
| 2 | 3378731 | 3378946 | + | NZ_CP011036.1 | Pseudoalteromonas nigrifaciens |
| 3 | 3208246 | 3208461 | + | NZ_CP011041.1 | Pseudoalteromonas tetraodonis |
| 4 | 3243834 | 3244049 | + | NZ_CP011030.1 | Pseudoalteromonas issachenkonii |
| 5 | 140059 | 140274 | - | NZ_CP011025.1 | Pseudoalteromonas arctica A 37-1-2 |
| 6 | 1676325 | 1676540 | + | NZ_CP019628.1 | Pseudoalteromonas aliena |
| 7 | 3541026 | 3541238 | + | NZ_CP011028.1 | Pseudoalteromonas espejiana DSM 9414 |
| 8 | 3456467 | 3456679 | + | NZ_CP033065.1 | Pseudoalteromonas agarivorans |
| 9 | 134248 | 134460 | - | NZ_CP027523.1 | Pseudoalteromonas carrageenovora |
| 10 | 3499041 | 3499253 | + | NZ_CP032090.1 | Pseudoalteromonas donghaensis |
| 11 | 3515560 | 3515772 | + | NZ_CP023464.1 | Pseudoalteromonas atlantica |
| 12 | 3339353 | 3339568 | - | NZ_CP031961.1 | Pseudoalteromonas tunicata |
| 13 | 2152594 | 2152806 | - | NZ_CP072133.1 | Pseudoalteromonas xiamenensis |
| 14 | 930096 | 930272 | - | NZ_CP009888.1 | Pseudoalteromonas piratica |
| 15 | 216185 | 216412 | - | NZ_CP011039.1 | Pseudoalteromonas spongiae UST010723-006 |
| 16 | 176617 | 176829 | - | NZ_CP013187.1 | Pseudoalteromonas phenolica |
| 17 | 1047789 | 1048001 | + | NZ_CP072425.1 | Pseudoalteromonas viridis |
| 18 | 1102853 | 1103059 | - | NZ_CP012362.1 | Oblitimonas alkaliphila |
| 19 | 806873 | 807064 | - | NZ_LR134510.1 | Actinobacillus delphinicola |
| 20 | 734895 | 735110 | - | NZ_CP012621.1 | Zobellella denitrificans |
| 21 | 508463 | 508684 | + | NZ_CP015029.1 | Frederiksenia canicola |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP011041.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01208.19 | 0.71 | 15 | 2990 | opposite-strand | Uroporphyrinogen decarboxylase (URO-D) |
| 2 | PF04353.15 | 0.81 | 17 | 2021 | same-strand | Regulator of RNA polymerase sigma(70) subunit, Rsd/AlgQ |
| 3 | PF00254.30 | 0.95 | 20 | 1190.0 | opposite-strand | FKBP-type peptidyl-prolyl cis-trans isomerase |
| 4 | PF01346.20 | 0.95 | 20 | 1190.0 | opposite-strand | Domain amino terminal to FKBP-type peptidyl-prolyl isomerase |
| 5 | PF00005.29 | 0.86 | 18 | 360.0 | same-strand | ABC transporter |
| 6 | PF12848.9 | 0.86 | 18 | 360.0 | same-strand | ABC transporter |
| 7 | PF09523.12 | 0.81 | 17 | 2266 | same-strand | Protein of unknown function (DUF2390) |
| 8 | PF00400.34 | 0.62 | 13 | -13 | same-strand | WD domain, G-beta repeat |
++ More..