| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | PqqA binding protein (Coenzyme PQQ synthesis protein D) (Pyrroloquinoline quinone biosynthesis protein D) |
| NCBI Accession ID | AM039952.1 |
| Organism | Xanthomonas campestris pv. vesicatoria (strain 85-10) |
| Left | 3709559 |
| Right | 3709837 |
| Strand | + |
| Nucleotide Sequence | ATGAGCGGCATTACCCGCCATAGCCAGCCGTCCCTGCGTGCAGGCGTGCGCCTGCAACATGACCGTGCGCGCGACCAGTGGGTATTGCTGGCGCCCGAACGCGTGGTCGAGCTGGACGACATCGCCTTGGTGGTCGCGCAGCGCTACGACGGCACACGCTCGCTGGCGCAGATCGCGCAGGAGCTGGCTGCAGAATTCGATGCGGACGCGGCCCAAATCGAAGCGGACGTGATTGAACTCACCGATACCCTGCATCAGAAGCGTTTGCTGCGGCTATGA |
| Sequence | MSGITRHSQPSLRAGVRLQHDRARDQWVLLAPERVVELDDIALVVAQRYDGTRSLAQIAQELAAEFDADAAQIEADVIELTDTLHQKRLLRL |
| Source of smORF | Swiss-Prot |
| Function | Functions as a PqqA binding protein and presents PqqA to PqqE, in the pyrroloquinoline quinone (PQQ) biosynthetic pathway. {ECO:0000255|HAMAP-Rule:MF_00655}. |
| Pubmed ID | 16237009 |
| Domain | CDD:414309 |
| Functional Category | Others |
| Uniprot ID | Q3BQI5 |
| ORF Length (Amino Acid) | 92 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3541260 | 3541538 | + | NZ_CP072268.1 | Xanthomonas euvesicatoria pv. alfalfae |
| 2 | 3667330 | 3667608 | + | NZ_CP048044.1 | Xanthomonas citri |
| 3 | 3147157 | 3147435 | + | NZ_CP033326.1 | Xanthomonas cucurbitae |
| 4 | 3372111 | 3372389 | + | NZ_LT853882.1 | Xanthomonas fragariae |
| 5 | 1413016 | 1413294 | - | NZ_CP058243.1 | Xanthomonas campestris pv. raphani |
| 6 | 5037674 | 5037952 | - | NZ_CP016878.1 | Xanthomonas hortorum |
| 7 | 1470441 | 1470719 | + | NZ_CP018725.1 | Xanthomonas vesicatoria ATCC 35937 |
| 8 | 3485826 | 3486104 | + | NZ_CP028127.1 | Xanthomonas vasicola pv. vasculorum |
| 9 | 3029171 | 3029449 | + | NZ_CP007810.1 | Xanthomonas oryzae pv. oryzicola |
| 10 | 4403102 | 4403371 | + | NZ_CP023465.1 | Lysobacter capsici |
| 11 | 4477524 | 4477772 | + | NZ_CP011129.1 | Lysobacter antibioticus |
| 12 | 784253 | 784486 | + | NZ_CP043476.1 | Xanthomonas hyacinthi |
| 13 | 328987 | 329220 | + | NC_017033.1 | Frateuria aurantia DSM 6220 |
| 14 | 4195506 | 4195754 | + | NZ_CP011131.1 | Lysobacter gummosus |
| 15 | 5434277 | 5434555 | - | NZ_CP011131.1 | Lysobacter gummosus |
| 16 | 1578602 | 1578850 | - | NZ_AP014940.1 | Lysobacter enzymogenes |
| 17 | 1086680 | 1086928 | + | NZ_CP043420.1 | Kushneria phosphatilytica |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04607.19 | 0.62 | 10 | 2105.0 | opposite-strand | Region found in RelA / SpoT proteins |
| 2 | PF02824.23 | 0.62 | 10 | 2105.0 | opposite-strand | TGS domain |
| 3 | PF13328.8 | 0.62 | 10 | 2105.0 | opposite-strand | HD domain |
| 4 | PF13291.8 | 0.62 | 10 | 2105.0 | opposite-strand | ACT domain |
| 5 | PF12706.9 | 1.0 | 16 | 746 | same-strand | Beta-lactamase superfamily domain |
| 6 | PF03070.18 | 1.0 | 16 | -3 | same-strand | TENA/THI-4/PQQC family |
| 7 | PF04055.23 | 0.94 | 15 | -3.0 | same-strand | Radical SAM superfamily |
| 8 | PF13186.8 | 1.0 | 16 | -3 | same-strand | Iron-sulfur cluster-binding domain |