Result : Q3BMG1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | AM039952.1 |
| Organism | Xanthomonas campestris pv. vesicatoria (strain 85-10) |
| Left | 4969936 |
| Right | 4970163 |
| Strand | - |
| Nucleotide Sequence | ATGGGCGGTTTCAGCATTTGGCACTGGCTGATCGTGCTGGTGATCGTGTTGCTGGTGTTCGGTACCAAGCGGCTCACCAGCGGTGCCAAGGATCTCGGCAGCGCGGTCAAGGAATTCAAGAAAGGCATGCACGACGACGACAAGCCGGCCGGCAAGCTCGGCGACGACTCCCGCACTGCCGAGCAGGCGCGTGAGGCGCAGGCCGAACGCGACCGCGACGCGCGCTGA |
| Sequence | MGGFSIWHWLIVLVIVLLVFGTKRLTSGAKDLGSAVKEFKKGMHDDDKPAGKLGDDSRTAEQAREAQAERDRDAR |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | 16237009 |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | Q3BMG1 |
| ORF Length (Amino Acid) | 75 |
++ More..
| Conservation Analysis |
No. of Species: 107
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4480454 | 4480681 | - | NZ_CP033326.1 | Xanthomonas cucurbitae |
| 2 | 4724472 | 4724699 | - | NZ_CP028127.1 | Xanthomonas vasicola pv. vasculorum |
| 3 | 4879722 | 4879949 | - | NZ_CP072268.1 | Xanthomonas euvesicatoria pv. alfalfae |
| 4 | 2709127 | 2709354 | - | NZ_CP018725.1 | Xanthomonas vesicatoria ATCC 35937 |
| 5 | 4949548 | 4949775 | - | NZ_CP048044.1 | Xanthomonas citri |
| 6 | 4074371 | 4074598 | + | NZ_CP007810.1 | Xanthomonas oryzae pv. oryzicola |
| 7 | 3375262 | 3375489 | - | NZ_CP016878.1 | Xanthomonas hortorum |
| 8 | 116895 | 117122 | + | NZ_LT853882.1 | Xanthomonas fragariae |
| 9 | 4750220 | 4750453 | - | NZ_CP058243.1 | Xanthomonas campestris pv. raphani |
| 10 | 2056252 | 2056485 | - | NZ_CP043476.1 | Xanthomonas hyacinthi |
| 11 | 106868 | 107101 | + | NC_016147.2 | Pseudoxanthomonas spadix BD-a59 |
| 12 | 4560406 | 4560633 | - | NZ_CP037883.1 | Stenotrophomonas indicatrix |
| 13 | 4045159 | 4045386 | - | NZ_CP012900.1 | Stenotrophomonas acidaminiphila |
| 14 | 4405824 | 4406051 | - | NZ_LS483377.1 | Stenotrophomonas maltophilia |
| 15 | 92488 | 92718 | + | NZ_CP046570.1 | Xanthomonas albilineans |
| 16 | 570461 | 570679 | + | NZ_CP060731.1 | Pseudoxanthomonas mexicana |
| 17 | 109386 | 109607 | + | NC_009379.1 | Polynucleobacter asymbioticus QLW-P1DMWA-1 |
| 18 | 2940608 | 2940841 | - | NZ_AP012547.1 | Sulfuritalea hydrogenivorans sk43H |
| 19 | 2046093 | 2046341 | + | NZ_CP040882.1 | Sutterella faecalis |
| 20 | 4303137 | 4303358 | - | NZ_CP015249.1 | Dokdonella koreensis DS-123 |
| 21 | 4105183 | 4105416 | - | NZ_CP037867.1 | Hydrogenophaga pseudoflava |
| 22 | 2894616 | 2894852 | + | NZ_CP071517.1 | Lysobacter arenosi |
| 23 | 801657 | 801899 | - | NZ_CP020046.1 | Thiomonas intermedia |
| 24 | 637247 | 637471 | - | NZ_LR134343.1 | Moraxella cuniculi |
| 25 | 2904553 | 2904783 | + | NZ_LT671418.1 | Herminiimonas arsenitoxidans |
| 26 | 3867193 | 3867420 | + | NC_018518.1 | Bordetella pertussis 18323 |
| 27 | 3923525 | 3923752 | + | NZ_AP019378.1 | Bordetella parapertussis |
| 28 | 136175 | 136402 | - | NZ_LR134326.1 | Bordetella bronchiseptica |
| 29 | 3110056 | 3110286 | - | NZ_CP019240.1 | Rhodoferax antarcticus |
| 30 | 1712061 | 1712285 | - | NZ_CP042218.1 | Luteimonas granuli |
| 31 | 4050094 | 4050330 | - | NZ_CP062803.1 | Cupriavidus basilensis |
| 32 | 1373845 | 1374099 | - | NZ_CP065150.1 | Vibrio kanaloae |
| 33 | 3234941 | 3235195 | - | NZ_CP039700.1 | Vibrio cyclitrophicus |
| 34 | 141096 | 141323 | - | NC_010170.1 | Bordetella petrii |
| 35 | 104445 | 104666 | + | NZ_CP030086.1 | Polynucleobacter paneuropaeus |
| 36 | 4411668 | 4411910 | - | NZ_CP019236.1 | Rhodoferax koreense |
| 37 | 98674 | 98904 | + | NZ_HG916765.1 | Castellaniella defragrans 65Phen |
| 38 | 390878 | 391102 | + | NZ_CP023406.1 | Luteimonas chenhongjianii |
| 39 | 2810456 | 2810695 | + | NZ_CP022987.1 | Pusillimonas thiosulfatoxidans |
| 40 | 5218152 | 5218382 | - | NZ_CP053986.1 | Achromobacter denitrificans |
| 41 | 93813 | 94067 | + | NC_011753.2 | Vibrio atlanticus |
| 42 | 496725 | 496958 | + | NZ_CP013414.1 | Burkholderia ubonensis |
| 43 | 191553 | 191780 | - | NZ_CP038034.1 | Achromobacter insolitus |
| 44 | 2484006 | 2484257 | - | NZ_CP068055.1 | Sutterella wadsworthensis |
| 45 | 2398905 | 2399153 | - | NZ_CP016278.1 | Diaphorobacter polyhydroxybutyrativorans |
| 46 | 179473 | 179697 | - | NZ_CP016171.1 | Bordetella bronchialis |
| 47 | 104330 | 104572 | + | NZ_CP007501.1 | Polynucleobacter duraquae |
| 48 | 2732540 | 2732767 | - | NZ_LR134302.1 | Achromobacter spanius |
| 49 | 1044703 | 1044951 | + | NZ_CP051298.1 | Alicycliphilus denitrificans |
| 50 | 3682471 | 3682704 | - | NZ_CP039287.1 | Cupriavidus necator H16 |
| 51 | 2664755 | 2664988 | - | NZ_CP013119.1 | Alcaligenes faecalis |
| 52 | 2571551 | 2571784 | + | NZ_CP035900.1 | Burkholderia glumae |
| 53 | 1877068 | 1877283 | - | NZ_CP009238.1 | Basilea psittacipulmonis DSM 24701 |
| 54 | 5979803 | 5980042 | - | NZ_CP017420.1 | Delftia tsuruhatensis |
| 55 | 2805910 | 2806152 | + | NZ_CP014035.2 | Vibrio fluvialis |
| 56 | 139179 | 139412 | - | NZ_CP016172.1 | Bordetella flabilis |
| 57 | 374725 | 374958 | + | NZ_CP002580.1 | Burkholderia plantarii |
| 58 | 641492 | 641710 | + | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
| 59 | 3632607 | 3632846 | - | NZ_CP024941.1 | Paraburkholderia terricola |
| 60 | 560719 | 560979 | + | NZ_CP003915.1 | Advenella mimigardefordensis DPN7 |
| 61 | 3149365 | 3149625 | - | NZ_CP051461.1 | Polaromonas vacuolata |
| 62 | 2100210 | 2100425 | + | NZ_CP053627.1 | Xylella taiwanensis |
| 63 | 313619 | 313852 | + | NZ_CP029843.1 | Lysobacter maris |
| 64 | 86380 | 86607 | + | NZ_HG322949.1 | Janthinobacterium agaricidamnosum NBRC 102515 = DSM 9628 |
| 65 | 545186 | 545425 | - | NZ_CP037952.1 | Parashewanella spongiae |
| 66 | 406493 | 406735 | - | NZ_CP040990.1 | Vibrio furnissii |
| 67 | 2044277 | 2044525 | - | NZ_CP047650.1 | Xylophilus rhododendri |
| 68 | 4746082 | 4746291 | - | NZ_CP037993.1 | Herbaspirillum huttiense |
| 69 | 3063334 | 3063576 | + | NZ_CP016414.1 | Vibrio scophthalmi |
| 70 | 4731134 | 4731337 | - | NZ_CP013737.1 | Herbaspirillum rubrisubalbicans M1 |
| 71 | 4547960 | 4548172 | + | NZ_CP034464.1 | Undibacterium parvum |
| 72 | 3298163 | 3298414 | - | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 73 | 2811595 | 2811831 | - | NZ_CP022741.1 | Vibrio qinghaiensis |
| 74 | 4651423 | 4651626 | - | NZ_CP011930.1 | Herbaspirillum seropedicae |
| 75 | 834182 | 834394 | - | NZ_AP021881.1 | Sulfuriferula nivalis |
| 76 | 780550 | 780774 | - | NC_008786.1 | Verminephrobacter eiseniae EF01-2 |
| 77 | 115530 | 115769 | - | NZ_CP046603.1 | Lysobacter soli |
| 78 | 5815956 | 5816195 | - | NZ_CP023465.1 | Lysobacter capsici |
| 79 | 3521111 | 3521314 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 80 | 5832701 | 5832931 | - | NZ_CP011131.1 | Lysobacter gummosus |
| 81 | 3741091 | 3741333 | - | NZ_CP041242.1 | Lysobacter alkalisoli |
| 82 | 1684610 | 1684843 | - | NZ_CP060820.1 | Lysobacter solisilvae (ex Woo and Kim 2020) |
| 83 | 199166 | 199417 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 84 | 602977 | 603222 | - | NZ_CP046378.1 | Shewanella algae |
| 85 | 5302397 | 5302648 | - | NZ_CP054254.1 | Klebsiella variicola |
| 86 | 1121121 | 1121354 | + | NZ_CP040709.1 | Inhella inkyongensis |
| 87 | 5012869 | 5013120 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 88 | 1972426 | 1972644 | - | NZ_CP041730.1 | Chitinimonas arctica |
| 89 | 1483820 | 1484035 | - | NZ_CP047165.1 | Pelistega ratti |
| 90 | 203855 | 204073 | - | NZ_CP024608.1 | Massilia violaceinigra |
| 91 | 392737 | 392958 | + | NZ_AP014940.1 | Lysobacter enzymogenes |
| 92 | 4722505 | 4722756 | - | NZ_CP043575.1 | Comamonas koreensis |
| 93 | 759436 | 759663 | - | NC_006513.1 | Aromatoleum aromaticum EbN1 |
| 94 | 1274659 | 1274865 | + | NZ_CP034909.1 | Ensifer alkalisoli |
| 95 | 4777398 | 4777607 | - | NZ_AP019312.1 | Chromobacterium haemolyticum |
| 96 | 1222692 | 1222934 | + | NZ_CP021455.1 | Comamonas serinivorans |
| 97 | 3195466 | 3195699 | - | NZ_CP064338.1 | Schlegelella thermodepolymerans |
| 98 | 3501323 | 3501547 | + | NZ_CP059560.1 | Aromatoleum petrolei |
| 99 | 349757 | 349963 | + | NC_014207.1 | Methylotenera versatilis 301 |
| 100 | 487883 | 488104 | + | NC_014394.1 | Gallionella capsiferriformans ES-2 |
| 101 | 2738158 | 2738388 | - | NZ_CP022579.1 | Oryzomicrobium terrae |
| 102 | 1488815 | 1489042 | + | NZ_CP013729.1 | Roseateles depolymerans |
| 103 | 4471457 | 4471660 | + | NZ_CP018845.1 | Herbaspirillum robiniae |
| 104 | 3577195 | 3577431 | - | NZ_CP046904.1 | Massilia flava |
| 105 | 4814742 | 4814936 | + | NZ_CP027860.1 | Ahniella affigens |
| 106 | 1940569 | 1940775 | + | NZ_CP031252.1 | Neisseria elongata |
| 107 | 1077162 | 1077359 | - | NC_007645.1 | Hahella chejuensis KCTC 2396 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP033326.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00902.20 | 0.98 | 105 | 548 | same-strand | Sec-independent protein translocase protein (TatC) |
++ More..