Result : A7Z570
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Small, acid-soluble spore protein N (SASP N) |
| NCBI Accession ID | CP000560.2 |
| Organism | Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42) (Bacillus amyloliquefaciens subsp. plantarum) |
| Left | 1840406 |
| Right | 1840552 |
| Strand | + |
| Nucleotide Sequence | ATGGGCATAAACAAGAAAGACGGCCAGCCGCAATACGCTCCGAGCCACTTAGGGACAAAACCCGTTAAATATAAACGCAACAAAGGGGAAAAGTTTCATGACAAGTCAAACGGACATCCGATTGTCATGCAGACGAAAGGCGAATAA |
| Sequence | MGINKKDGQPQYAPSHLGTKPVKYKRNKGEKFHDKSNGHPIVMQTKGE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl27883. Profile Description: Small acid-soluble spore protein N family. acid-soluble spore protein N; Provisional |
| Pubmed ID | 17704766 |
| Domain | CDD:332704 |
| Functional Category | Others |
| Uniprot ID | A7Z570 |
| ORF Length (Amino Acid) | 48 |
++ More..
| Conservation Analysis |
No. of Species: 21
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1879315 | 1879461 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 2 | 2076370 | 2076516 | - | NZ_CP011937.1 | Bacillus velezensis |
| 3 | 39982 | 40128 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 4 | 1857471 | 1857617 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 5 | 1838577 | 1838723 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 6 | 1894150 | 1894296 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 7 | 1930264 | 1930410 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 8 | 1892344 | 1892490 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 9 | 2043237 | 2043383 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 10 | 1989606 | 1989749 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 2040190 | 2040333 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 2172777 | 2172920 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 13 | 3545966 | 3546109 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 14 | 1779702 | 1779845 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 15 | 3535948 | 3536091 | - | NZ_CP043404.1 | Bacillus safensis |
| 16 | 3059017 | 3059160 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 17 | 153086 | 153229 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 18 | 1445185 | 1445328 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 19 | 2185185 | 2185328 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 20 | 4999856 | 4999999 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 21 | 1961906 | 1962049 | + | NZ_CP070511.1 | Parageobacillus toebii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP053376.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08179.14 | 0.67 | 14 | 3985.5 | opposite-strand | Small acid-soluble spore protein P family |
| 2 | PF08175.14 | 0.67 | 14 | 3800.5 | opposite-strand | Small acid-soluble spore protein O family |
| 3 | PF00330.22 | 0.86 | 18 | 851.0 | same-strand | Aconitase family (aconitate hydratase) |
| 4 | PF00694.21 | 0.86 | 18 | 851.0 | same-strand | Aconitase C-terminal domain |
| 5 | PF00578.23 | 1.0 | 21 | 269 | same-strand | AhpC/TSA family |
| 6 | PF08534.12 | 1.0 | 21 | 269 | same-strand | Redoxin |
| 7 | PF13905.8 | 1.0 | 21 | 269 | same-strand | Thioredoxin-like |
| 8 | PF13098.8 | 1.0 | 21 | 269 | same-strand | Thioredoxin-like domain |
| 9 | PF13040.8 | 0.95 | 20 | 65.0 | same-strand | Fur-regulated basic protein B |
| 10 | PF19824.1 | 1.0 | 21 | 35 | same-strand | Small, acid-soluble spore protein Tlp |
| 11 | PF03061.24 | 1.0 | 21 | 372.0 | same-strand | Thioesterase superfamily |
| 12 | PF13279.8 | 1.0 | 21 | 372 | same-strand | Thioesterase-like superfamily |
++ More..