Result : Q3B0C9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Photosystem II reaction center protein J (PSII-J) |
| NCBI Accession ID | CP000097.1 |
| Organism | Synechococcus sp. (strain CC9902) |
| Left | 241185 |
| Right | 241385 |
| Strand | - |
| Nucleotide Sequence | ATGAGCAGTAAGAAATCTCTCTATCCAGACGGTCGAATCCCTGATCGTTTGCCCGACGGACGCCCTGCAGTGGCTTGGCGCTCCCGCTGGACTGAAGGTGTATTGCCACTTTGGCTTGTCGCTACGGCTGGTGGCATGGCAGTGTTTTTTGTTGTGGGCTTGTTCTTCTTCGGGGCTTATACCGGAGTCGGTTCCGCCTGA |
| Sequence | MSSKKSLYPDGRIPDRLPDGRPAVAWRSRWTEGVLPLWLVATAGGMAVFFVVGLFFFGAYTGVGSA |
| Source of smORF | Swiss-Prot |
| Function | One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. {ECO:0000255|HAMAP-Rule:MF_01305}. |
| Pubmed ID | |
| Domain | CDD:421512 |
| Functional Category | Others |
| Uniprot ID | Q3B0C9 |
| ORF Length (Amino Acid) | 66 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2067821 | 2068021 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 2 | 319143 | 319340 | + | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_019675.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00301.22 | 1.0 | 2 | 1679.0 | same-strand | Rubredoxin |
| 2 | PF14870.8 | 1.0 | 2 | 645.5 | same-strand | Photosynthesis system II assembly factor YCF48 |
| 3 | PF00284.22 | 1.0 | 2 | 293.5 | same-strand | Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit |
| 4 | PF00283.21 | 1.0 | 2 | 280 | same-strand | Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits |
++ More..