Result : Q3AW84
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S17 |
| NCBI Accession ID | CP000097.1 |
| Organism | Synechococcus sp. (strain CC9902) |
| Left | 1874144 |
| Right | 1874431 |
| Strand | + |
| Nucleotide Sequence | ATGGCAGTTAAAGAACGGGTCGGCACCGTCGTCAGCGACAAGATGGAGAAAACAGTGGTGGTTGCGGTGGAAACCCGCTTCCCCCATCCCATCTATCAAAAGACGGTCAGCCGCACCACCCGCTACAAAGCCCACGATGAAGACAACTCCTGTCGCGTCGGAGACCGTGTTCGCATCACGGAAACCCGTCCGATGAGTCGCCAAAAACGTTGGGCGATTGCTGAAGTTCTCAGCCACAGCCCAAAAGCTGCGGCTGCTGAAGCGAAAGCAGAGGAGGCCAACCAGTGA |
| Sequence | MAVKERVGTVVSDKMEKTVVVAVETRFPHPIYQKTVSRTTRYKAHDEDNSCRVGDRVRITETRPMSRQKRWAIAEVLSHSPKAAAAEAKAEEANQ |
| Source of smORF | Swiss-Prot |
| Function | One of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_01345}. |
| Pubmed ID | |
| Domain | CDD:412327 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q3AW84 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 205
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1757794 | 1758045 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 2 | 1559967 | 1560233 | - | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 3 | 4140979 | 4141239 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 4 | 2171253 | 2171498 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 5 | 77911 | 78159 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 6 | 2470665 | 2470913 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 7 | 4469218 | 4469469 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 8 | 2669255 | 2669506 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
| 9 | 4580741 | 4580986 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 10 | 5461727 | 5461975 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 11 | 4000513 | 4000761 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 12 | 5627971 | 5628219 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 13 | 6148920 | 6149168 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 14 | 5539003 | 5539254 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 15 | 5189871 | 5190116 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 16 | 6461150 | 6461389 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 17 | 61336 | 61584 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 18 | 216890 | 217177 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 19 | 2617943 | 2618194 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 20 | 173990 | 174235 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 21 | 3738714 | 3738962 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 22 | 3394430 | 3394681 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 23 | 6285164 | 6285412 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 24 | 4733908 | 4734159 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 25 | 644746 | 644994 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 26 | 5287344 | 5287586 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 27 | 3270342 | 3270587 | - | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 28 | 1924502 | 1924792 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 29 | 1172778 | 1173044 | - | NZ_CP034413.2 | Dysosmobacter welbionis |
| 30 | 4114889 | 4115140 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 31 | 2780057 | 2780308 | - | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 32 | 2341970 | 2342230 | - | NZ_CP012332.1 | Vulgatibacter incomptus |
| 33 | 923333 | 923587 | + | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 34 | 1618091 | 1618354 | - | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
| 35 | 408325 | 408585 | + | NZ_CP048436.1 | Flavonifractor plautii |
| 36 | 2772013 | 2772252 | - | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 37 | 2567923 | 2568201 | + | NZ_CP060713.1 | Nocardioides mesophilus |
| 38 | 3765527 | 3765817 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 39 | 146757 | 147011 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 40 | 1250927 | 1251160 | + | NZ_CP011454.1 | Gemmatimonas phototrophica |
| 41 | 1052630 | 1052926 | + | NC_012489.1 | Gemmatimonas aurantiaca T-27 |
| 42 | 702189 | 702422 | + | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 43 | 725536 | 725820 | - | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 44 | 1036129 | 1036368 | - | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 45 | 271219 | 271473 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 46 | 784864 | 785127 | - | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
| 47 | 4179152 | 4179406 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 48 | 5774487 | 5774720 | - | NZ_CP022753.1 | Nocardiopsis gilva YIM 90087 |
| 49 | 3818723 | 3818977 | - | NZ_CP009687.1 | Clostridium aceticum |
| 50 | 3676162 | 3676428 | - | NC_011831.1 | Chloroflexus aggregans DSM 9485 |
| 51 | 414044 | 414277 | + | NZ_CP060789.1 | Tessaracoccus defluvii |
| 52 | 1470082 | 1470327 | - | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 53 | 291332 | 291631 | + | NZ_CP030032.1 | Bradymonas sediminis |
| 54 | 4307102 | 4307377 | - | NZ_CP009896.1 | Pimelobacter simplex |
| 55 | 247863 | 248096 | + | NC_014926.1 | Thermovibrio ammonificans HB-1 |
| 56 | 444821 | 445069 | + | NZ_AP022873.1 | Dissulfurispira thermophila |
| 57 | 377279 | 377542 | + | NC_014836.1 | Desulfurispirillum indicum S5 |
| 58 | 1452847 | 1453128 | - | NZ_CP041146.1 | Nocardioides humi |
| 59 | 4989629 | 4989901 | + | NZ_CP020563.1 | Kitasatospora albolonga |
| 60 | 1334783 | 1335055 | + | NZ_CP022295.1 | Nocardioides aromaticivorans |
| 61 | 47937 | 48203 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 62 | 1791782 | 1792045 | + | NZ_CP021434.1 | Tumebacillus avium |
| 63 | 2152736 | 2153002 | - | NZ_LR134442.1 | Propionibacterium australiense |
| 64 | 2939650 | 2939886 | + | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 65 | 1151442 | 1151705 | + | NZ_CP011801.1 | Nitrospira moscoviensis |
| 66 | 2019243 | 2019548 | - | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
| 67 | 3980472 | 3980744 | - | NZ_CP027793.1 | Rhodococcus hoagii |
| 68 | 5677537 | 5677809 | + | NZ_AP023440.1 | Streptomyces glomeroaurantiacus |
| 69 | 1220345 | 1220587 | - | NC_013522.1 | Thermanaerovibrio acidaminovorans DSM 6589 |
| 70 | 1696461 | 1696694 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 71 | 7506016 | 7506291 | + | NC_016582.1 | Streptomyces bingchenggensis BCW-1 |
| 72 | 2074498 | 2074731 | - | NZ_LT985188.1 | Micropruina glycogenica |
| 73 | 2282576 | 2282833 | - | NC_015520.1 | Mahella australiensis 50-1 BON |
| 74 | 3934870 | 3935112 | - | NC_014963.1 | Terriglobus saanensis SP1PR4 |
| 75 | 9177947 | 9178219 | - | NZ_CP063373.1 | Streptomyces ferrugineus |
| 76 | 970182 | 970427 | + | NC_013501.1 | Rhodothermus marinus DSM 4252 |
| 77 | 5698915 | 5699154 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 78 | 2948713 | 2948952 | - | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 79 | 1751856 | 1752089 | + | NZ_CP043611.1 | Paenibacillus antarcticus |
| 80 | 4687481 | 4687720 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 81 | 5017097 | 5017336 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 82 | 4391232 | 4391471 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 83 | 5294549 | 5294788 | - | NZ_CP009288.1 | Paenibacillus durus |
| 84 | 4071428 | 4071670 | - | NZ_CP042806.1 | Terriglobus albidus |
| 85 | 475775 | 476005 | - | NZ_CP042909.1 | Thermosulfurimonas marina |
| 86 | 613744 | 614031 | + | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 87 | 606907 | 607194 | + | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 88 | 1137672 | 1137905 | + | NZ_CP016757.1 | Cloacibacillus porcorum |
| 89 | 1086783 | 1087016 | + | NC_013131.1 | Catenulispora acidiphila DSM 44928 |
| 90 | 335444 | 335734 | + | NC_008578.1 | Acidothermus cellulolyticus 11B |
| 91 | 3933544 | 3933786 | + | NZ_CP046052.1 | Methylocystis heyeri |
| 92 | 5220700 | 5220960 | - | NC_009767.1 | Roseiflexus castenholzii DSM 13941 |
| 93 | 222945 | 223178 | + | NZ_CP058670.1 | Chryseoglobus indicus |
| 94 | 6016366 | 6016620 | + | NC_015510.1 | Haliscomenobacter hydrossis DSM 1100 |
| 95 | 396038 | 396277 | + | NC_013943.1 | Denitrovibrio acetiphilus DSM 12809 |
| 96 | 3986954 | 3987193 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 97 | 8289594 | 8289887 | + | NZ_AP022870.1 | Phytohabitans flavus |
| 98 | 1022153 | 1022425 | + | NZ_CP049933.1 | Leucobacter coleopterorum |
| 99 | 3260480 | 3260752 | + | NZ_CP049863.1 | Leucobacter viscericola |
| 100 | 1257909 | 1258163 | - | NZ_AP019735.1 | Alistipes communis |
| 101 | 4841846 | 4842085 | - | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 102 | 669761 | 670003 | + | NC_014011.1 | Aminobacterium colombiense DSM 12261 |
| 103 | 719587 | 719820 | + | NC_015588.1 | Isoptericola variabilis 225 |
| 104 | 3197112 | 3197399 | + | NZ_CP009291.1 | Novosphingobium pentaromativorans US6-1 |
| 105 | 3053459 | 3053716 | - | NZ_CP045737.1 | Aeromicrobium yanjiei |
| 106 | 3074280 | 3074519 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 107 | 938827 | 939105 | + | NC_020520.1 | Ilumatobacter coccineus YM16-304 |
| 108 | 1664954 | 1665241 | - | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 109 | 993272 | 993571 | + | NZ_CP007389.1 | Thermosipho melanesiensis |
| 110 | 808896 | 809162 | + | NZ_CP043042.1 | Marinobacter fonticola |
| 111 | 1334416 | 1334688 | + | NZ_CP049934.1 | Leucobacter insecticola |
| 112 | 3065992 | 3066249 | - | NZ_CP026952.1 | Aeromicrobium chenweiae |
| 113 | 2017769 | 2018035 | - | NZ_CP007514.1 | Rubrobacter radiotolerans |
| 114 | 243239 | 243499 | + | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 115 | 698958 | 699224 | + | NZ_LS483427.1 | Arcanobacterium haemolyticum |
| 116 | 4422168 | 4422407 | - | NC_018014.1 | Terriglobus roseus DSM 18391 |
| 117 | 2312867 | 2313139 | - | NZ_CP051774.1 | Luteolibacter luteus |
| 118 | 2251342 | 2251611 | - | NZ_CP046415.1 | Guyparkeria halophila |
| 119 | 5269960 | 5270205 | + | NZ_CP030840.1 | Acidisarcina polymorpha |
| 120 | 3061456 | 3061752 | + | NC_019793.1 | Deinococcus peraridilitoris DSM 19664 |
| 121 | 3725343 | 3725606 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 122 | 1918368 | 1918634 | + | NZ_CP012362.1 | Oblitimonas alkaliphila |
| 123 | 244481 | 244714 | + | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 124 | 3132630 | 3132920 | - | NZ_CP013254.1 | Kocuria flava |
| 125 | 1543859 | 1544125 | - | NZ_CP070228.1 | Arcanobacterium phocisimile |
| 126 | 3065654 | 3065935 | - | NC_014830.1 | Intrasporangium calvum DSM 43043 |
| 127 | 1626831 | 1627067 | - | NZ_CP061003.1 | Agrobacterium tumefaciens |
| 128 | 1240344 | 1240643 | + | NC_011653.1 | Thermosipho africanus TCF52B |
| 129 | 506419 | 506673 | + | NZ_CP011060.1 | Borrelia hermsii CC1 |
| 130 | 6055718 | 6055981 | + | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 131 | 503720 | 503974 | + | NZ_CP007022.1 | Borrelia parkeri HR1 |
| 132 | 503847 | 504101 | + | NC_008710.1 | Borrelia turicatae 91E135 |
| 133 | 1924619 | 1924861 | - | NZ_CP017940.1 | Phyllobacterium zundukense |
| 134 | 224593 | 224850 | + | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 135 | 1174582 | 1174845 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 136 | 4285031 | 4285300 | + | NZ_CP029254.1 | Streptomyces spongiicola |
| 137 | 4057369 | 4057638 | + | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 138 | 3593725 | 3593988 | - | NC_008255.1 | Cytophaga hutchinsonii ATCC 33406 |
| 139 | 520960 | 521214 | + | NC_011244.1 | Borrelia recurrentis A1 |
| 140 | 5614738 | 5614995 | - | NZ_CP022088.2 | Nocardia brasiliensis |
| 141 | 3027951 | 3028211 | - | NZ_CP043420.1 | Kushneria phosphatilytica |
| 142 | 2587642 | 2587875 | - | NZ_CP015961.1 | Dietzia timorensis |
| 143 | 305742 | 306029 | + | NZ_CP029494.1 | Deinococcus irradiatisoli |
| 144 | 886607 | 886849 | + | NZ_CP042808.1 | Acetobacter oryzoeni |
| 145 | 1544371 | 1544604 | + | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 146 | 3095947 | 3096234 | - | NC_014958.1 | Deinococcus maricopensis DSM 21211 |
| 147 | 520911 | 521165 | + | NZ_CP028884.1 | Borrelia turcica IST7 |
| 148 | 1711448 | 1711684 | - | NC_012483.1 | Acidobacterium capsulatum ATCC 51196 |
| 149 | 404251 | 404505 | - | NZ_CP024333.1 | Borrelia miyamotoi |
| 150 | 1084969 | 1085202 | + | NZ_CP035108.1 | Geovibrio thiophilus |
| 151 | 2000451 | 2000693 | - | NZ_CP022110.1 | Nitrospirillum amazonense CBAmc |
| 152 | 3274348 | 3274599 | - | NZ_CP016282.1 | Cryobacterium arcticum |
| 153 | 3457003 | 3457254 | + | NZ_CP030033.1 | Cryobacterium soli |
| 154 | 271280 | 271543 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 155 | 132497 | 132736 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 156 | 3088488 | 3088742 | - | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
| 157 | 2870402 | 2870677 | - | NZ_CP029145.1 | Hymenobacter nivis |
| 158 | 1063656 | 1063925 | - | NZ_LT629973.1 | Akkermansia glycaniphila |
| 159 | 1214373 | 1214612 | - | NC_016027.1 | Komagataeibacter medellinensis NBRC 3288 |
| 160 | 3586786 | 3587043 | - | NZ_CP013187.1 | Pseudoalteromonas phenolica |
| 161 | 2653580 | 2653834 | - | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
| 162 | 1887464 | 1887727 | - | NZ_CP046883.1 | Corynebacterium anserum |
| 163 | 482452 | 482712 | + | NZ_CP009247.1 | Corynebacterium frankenforstense DSM 45800 |
| 164 | 5963963 | 5964214 | - | NC_020126.1 | Myxococcus stipitatus DSM 14675 |
| 165 | 2465053 | 2465292 | - | NZ_CP045423.1 | Microvirga thermotolerans |
| 166 | 2019087 | 2019332 | + | NC_011894.1 | Methylobacterium nodulans ORS 2060 |
| 167 | 1512225 | 1512482 | + | NZ_CP072425.1 | Pseudoalteromonas viridis |
| 168 | 5032238 | 5032468 | - | NZ_CP017147.1 | Bosea vaviloviae |
| 169 | 1504746 | 1504994 | + | NC_007406.1 | Nitrobacter winogradskyi Nb-255 |
| 170 | 644912 | 645181 | + | NZ_CP016353.1 | Prauserella marina |
| 171 | 3752600 | 3752851 | + | NC_017030.1 | Corallococcus coralloides DSM 2259 |
| 172 | 3859066 | 3859317 | + | NC_008095.1 | Myxococcus xanthus DK 1622 |
| 173 | 3899150 | 3899401 | + | NZ_CP022203.1 | Corallococcus macrosporus DSM 14697 |
| 174 | 4597024 | 4597266 | - | NZ_CP012109.1 | Myxococcus hansupus |
| 175 | 3253787 | 3254017 | + | NC_014664.1 | Rhodomicrobium vannielii ATCC 17100 |
| 176 | 643877 | 644128 | - | NZ_CP024422.1 | Paracoccus yeei |
| 177 | 1121277 | 1121528 | - | NZ_CP030239.1 | Paracoccus mutanolyticus |
| 178 | 404856 | 405128 | - | NZ_AP021898.1 | Akkermansia muciniphila |
| 179 | 1092254 | 1092496 | - | NC_017096.1 | Caldisericum exile AZM16c01 |
| 180 | 1127924 | 1128193 | - | NZ_CP014635.1 | Corynebacterium simulans |
| 181 | 5777518 | 5777772 | - | NZ_CP015136.1 | Luteitalea pratensis |
| 182 | 370411 | 370674 | + | NC_017301.2 | Corynebacterium pseudotuberculosis C231 |
| 183 | 1908045 | 1908308 | + | NZ_LT906443.1 | Corynebacterium ulcerans |
| 184 | 89397 | 89639 | - | NZ_CP020083.1 | Blastomonas fulva |
| 185 | 7990026 | 7990268 | + | NZ_CP022163.1 | Melittangium boletus DSM 14713 |
| 186 | 1797175 | 1797423 | - | NZ_CP045072.1 | Paracoccus kondratievae |
| 187 | 1958739 | 1959017 | - | NZ_CP033897.1 | Corynebacterium gerontici |
| 188 | 2038199 | 2038477 | - | NZ_CP033898.1 | Corynebacterium pseudopelargi |
| 189 | 2054899 | 2055177 | - | NZ_CP035299.1 | Corynebacterium pelargi |
| 190 | 604187 | 604447 | + | NZ_LS483459.1 | Corynebacterium jeikeium |
| 191 | 400254 | 400517 | + | NZ_CP009245.1 | Corynebacterium aquilae DSM 44791 |
| 192 | 1072766 | 1073002 | - | NC_014314.1 | Dehalogenimonas lykanthroporepellens BL-DC-9 |
| 193 | 903697 | 903933 | + | NZ_CP018911.1 | Glycocaulis alkaliphilus |
| 194 | 1899179 | 1899430 | + | NC_014414.1 | Parvularcula bermudensis HTCC2503 |
| 195 | 2968027 | 2968263 | - | NC_008048.1 | Sphingopyxis alaskensis RB2256 |
| 196 | 1132962 | 1133213 | + | NZ_CP029479.1 | Phenylobacterium parvum |
| 197 | 4416103 | 4416342 | + | NZ_CP009122.1 | Sphingopyxis fribergensis |
| 198 | 1880919 | 1881158 | + | NZ_CP024201.1 | Caulobacter mirabilis |
| 199 | 4888576 | 4888806 | + | NZ_CP009429.1 | Sphingopyxis macrogoltabida |
| 200 | 2971073 | 2971312 | + | NZ_CP026100.1 | Caulobacter flavus |
| 201 | 1445897 | 1446133 | - | NZ_CP020538.1 | Sphingobium herbicidovorans |
| 202 | 1762612 | 1762848 | + | NZ_CP022745.1 | Sphingobium xenophagum |
| 203 | 2535285 | 2535521 | - | NZ_CP060035.1 | Sphingobium fuliginis |
| 204 | 648198 | 648434 | + | NC_014006.1 | Sphingobium japonicum UT26S |
| 205 | 2132074 | 2132310 | - | NZ_AP017655.1 | Sphingobium cloacae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP034413.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00203.23 | 0.96 | 197 | 1837 | same-strand | Ribosomal protein S19 |
| 2 | PF00237.21 | 1.0 | 204 | 1431.5 | same-strand | Ribosomal protein L22p/L17e |
| 3 | PF00189.22 | 1.0 | 204 | 688.0 | same-strand | Ribosomal protein S3, C-terminal domain |
| 4 | PF07650.19 | 1.0 | 204 | 688.0 | same-strand | KH domain |
| 5 | PF00252.20 | 1.0 | 204 | 244.0 | same-strand | Ribosomal protein L16p/L10e |
| 6 | PF00831.25 | 1.0 | 205 | 19 | same-strand | Ribosomal L29 protein |
| 7 | PF00238.21 | 0.93 | 191 | 36 | same-strand | Ribosomal protein L14p/L23e |
| 8 | PF17136.6 | 0.9 | 184 | 424.5 | same-strand | Ribosomal proteins 50S L24/mitochondrial 39S L24 |
| 9 | PF00467.31 | 0.8 | 164 | 419.0 | same-strand | KOW motif |
| 10 | PF00673.23 | 0.91 | 187 | 783 | same-strand | ribosomal L5P family C-terminus |
| 11 | PF00281.21 | 0.91 | 187 | 783 | same-strand | Ribosomal protein L5 |
| 12 | PF00410.21 | 0.9 | 185 | 1617 | same-strand | Ribosomal protein S8 |
| 13 | PF00253.23 | 0.67 | 138 | 1360.0 | same-strand | Ribosomal protein S14p/S29e |
++ More..