ProsmORF-pred
Result : Q3ATT3
Protein Information
Information Type Description
Protein name UPF0235 protein Cag_0319
NCBI Accession ID CP000108.1
Organism Chlorobium chlorochromatii (strain CaD3)
Left 355078
Right 355377
Strand +
Nucleotide Sequence GTGGTTGAGCTTCAGGAAAAAAACGGGAGCGTTTGCATTGCGGTGCGGGCGCAACCCCGTTCTTCAAAAAGTATGGTGAGTGGCGAGTGGAATGGGGCGTTAAAGGTGCATTTACAATCGCCACCTGTTGATGATGCAGCGAATGAAGAGTGTTGCCGTTTGCTTGCTCGCTTATTTCAAGTTCCCCCGTCTCGTGTTCATTTGGTTGCAGGGCACTCATCTCGCAATAAACGTGTAATGGTGGAAGGGGTAAGTGCTGCCATGGCAACCGAGCTGCTCCAGCCGTTTCTTCATACCTAA
Sequence MVELQEKNGSVCIAVRAQPRSSKSMVSGEWNGALKVHLQSPPVDDAANEECCRLLARLFQVPPSRVHLVAGHSSRNKRVMVEGVSAAMATELLQPFLHT
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl00811. Profile Description: Uncharacterized ACR, YggU family COG1872. hypothetical protein; Validated
Pubmed ID
Domain CDD:412584
Functional Category Others
Uniprot ID Q3ATT3
ORF Length (Amino Acid) 99
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 5
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 2498604 2498897 - NC_011060.1 Pelodictyon phaeoclathratiforme BU-1
2 2250789 2251094 - NC_010803.1 Chlorobium limicola DSM 245
3 347838 348143 + NC_007512.1 Pelodictyon luteolum DSM 273
4 2041411 2041725 - NC_011059.1 Prosthecochloris aestuarii DSM 271
5 2414868 2415158 - NC_008639.1 Chlorobium phaeobacteroides DSM 266
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_008639.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00148.21 1.0 5 3198 same-strand Nitrogenase component 1 type Oxidoreductase
2 PF05036.15 0.6 3 2150 same-strand SPOR domain
3 PF13742.8 1.0 5 1173 opposite-strand OB-fold nucleic acid binding domain
4 PF01336.27 1.0 5 1173 opposite-strand OB-fold nucleic acid binding domain
5 PF02348.21 1.0 5 452 same-strand Cytidylyltransferase
6 PF02686.17 1.0 5 12 same-strand Glu-tRNAGln amidotransferase C subunit
7 PF00285.23 1.0 5 364 same-strand Citrate synthase, C-terminal domain
8 PF00691.22 0.6 3 2109 same-strand OmpA family
9 PF01936.20 1.0 5 3155 same-strand NYN domain
10 PF12872.9 1.0 5 3155 same-strand OST-HTH/LOTUS domain
11 PF00403.28 0.8 4 3882.0 same-strand Heavy-metal-associated domain
12 PF02580.18 0.6 3 3 same-strand D-Tyr-tRNA(Tyr) deacylase
++ More..