Protein Information |
Information Type | Description |
---|---|
Protein name | UPF0235 protein Cag_0319 |
NCBI Accession ID | CP000108.1 |
Organism | Chlorobium chlorochromatii (strain CaD3) |
Left | 355078 |
Right | 355377 |
Strand | + |
Nucleotide Sequence | GTGGTTGAGCTTCAGGAAAAAAACGGGAGCGTTTGCATTGCGGTGCGGGCGCAACCCCGTTCTTCAAAAAGTATGGTGAGTGGCGAGTGGAATGGGGCGTTAAAGGTGCATTTACAATCGCCACCTGTTGATGATGCAGCGAATGAAGAGTGTTGCCGTTTGCTTGCTCGCTTATTTCAAGTTCCCCCGTCTCGTGTTCATTTGGTTGCAGGGCACTCATCTCGCAATAAACGTGTAATGGTGGAAGGGGTAAGTGCTGCCATGGCAACCGAGCTGCTCCAGCCGTTTCTTCATACCTAA |
Sequence | MVELQEKNGSVCIAVRAQPRSSKSMVSGEWNGALKVHLQSPPVDDAANEECCRLLARLFQVPPSRVHLVAGHSSRNKRVMVEGVSAAMATELLQPFLHT |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00811. Profile Description: Uncharacterized ACR, YggU family COG1872. hypothetical protein; Validated |
Pubmed ID | |
Domain | CDD:412584 |
Functional Category | Others |
Uniprot ID | Q3ATT3 |
ORF Length (Amino Acid) | 99 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2498604 | 2498897 | - | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
2 | 2250789 | 2251094 | - | NC_010803.1 | Chlorobium limicola DSM 245 |
3 | 347838 | 348143 | + | NC_007512.1 | Pelodictyon luteolum DSM 273 |
4 | 2041411 | 2041725 | - | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
5 | 2414868 | 2415158 | - | NC_008639.1 | Chlorobium phaeobacteroides DSM 266 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00148.21 | 1.0 | 5 | 3198 | same-strand | Nitrogenase component 1 type Oxidoreductase |
2 | PF05036.15 | 0.6 | 3 | 2150 | same-strand | SPOR domain |
3 | PF13742.8 | 1.0 | 5 | 1173 | opposite-strand | OB-fold nucleic acid binding domain |
4 | PF01336.27 | 1.0 | 5 | 1173 | opposite-strand | OB-fold nucleic acid binding domain |
5 | PF02348.21 | 1.0 | 5 | 452 | same-strand | Cytidylyltransferase |
6 | PF02686.17 | 1.0 | 5 | 12 | same-strand | Glu-tRNAGln amidotransferase C subunit |
7 | PF00285.23 | 1.0 | 5 | 364 | same-strand | Citrate synthase, C-terminal domain |
8 | PF00691.22 | 0.6 | 3 | 2109 | same-strand | OmpA family |
9 | PF01936.20 | 1.0 | 5 | 3155 | same-strand | NYN domain |
10 | PF12872.9 | 1.0 | 5 | 3155 | same-strand | OST-HTH/LOTUS domain |
11 | PF00403.28 | 0.8 | 4 | 3882.0 | same-strand | Heavy-metal-associated domain |
12 | PF02580.18 | 0.6 | 3 | 3 | same-strand | D-Tyr-tRNA(Tyr) deacylase |