Protein Information |
Information Type | Description |
---|---|
Protein name | 30S ribosomal protein S20 |
NCBI Accession ID | CP000108.1 |
Organism | Chlorobium chlorochromatii (strain CaD3) |
Left | 535338 |
Right | 535619 |
Strand | + |
Nucleotide Sequence | ATGCCTTTACACAAATCGGCTGAAAAAAGACTGCGCCAGTCAGAAAAAAGAAATGCTCGCAACCGTGCCCGCAAAAAAGAGTTGAAAGTACTTGTTAAAACCATGCAAAAGCTGATTGAAGCAAGTGCAGCTAAGCCTGAGGTTGAAACCGCATATCGTTCAGTGGTGCAAAAGCTCGATCGTCTTGGTGTGAAGCGTTACATTCACGCAAACAAGGCTTCCCGCAAAAAGTCGCAAATTACTCGCGATTTCAATACTTACATGCAGTCAGCTCAGCAATAA |
Sequence | MPLHKSAEKRLRQSEKRNARNRARKKELKVLVKTMQKLIEASAAKPEVETAYRSVVQKLDRLGVKRYIHANKASRKKSQITRDFNTYMQSAQQ |
Source of smORF | Swiss-Prot |
Function | Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}. |
Pubmed ID | |
Domain | CDD:412349 |
Functional Category | Ribosomal_protein |
Uniprot ID | Q3ATE6 |
ORF Length (Amino Acid) | 93 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 355152 | 355427 | + | NC_010803.1 | Chlorobium limicola DSM 245 |
2 | 407969 | 408244 | + | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
3 | 431461 | 431736 | + | NC_008639.1 | Chlorobium phaeobacteroides DSM 266 |
4 | 1969081 | 1969356 | - | NC_007512.1 | Pelodictyon luteolum DSM 273 |
5 | 1945708 | 1945983 | - | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
6 | 422001 | 422276 | + | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
7 | 271656 | 271934 | + | NC_002932.3 | Chlorobaculum tepidum TLS |
8 | 271065 | 271343 | + | NZ_CP017305.1 | Chlorobaculum limnaeum |
9 | 692636 | 692917 | - | NC_011026.1 | Chloroherpeton thalassium ATCC 35110 |
10 | 2695119 | 2695421 | - | NZ_CP063458.1 | Humisphaera borealis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF12704.9 | 0.8 | 8 | 3605.5 | same-strand | MacB-like periplasmic core domain |
2 | PF02687.23 | 0.8 | 8 | 3605.5 | same-strand | FtsX-like permease family |
3 | PF00664.25 | 0.8 | 8 | 1651.5 | opposite-strand | ABC transporter transmembrane region |
4 | PF00005.29 | 0.8 | 8 | 1651.5 | opposite-strand | ABC transporter |
5 | PF02878.18 | 0.8 | 8 | 225.5 | opposite-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I |
6 | PF02879.18 | 0.8 | 8 | 225.5 | opposite-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II |
7 | PF02880.18 | 0.8 | 8 | 225.5 | opposite-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III |
8 | PF01330.23 | 0.9 | 9 | 118 | same-strand | RuvA N terminal domain |
9 | PF14520.8 | 0.9 | 9 | 118 | same-strand | Helix-hairpin-helix domain |
10 | PF07499.15 | 0.9 | 9 | 118 | same-strand | RuvA, C-terminal domain |
11 | PF08245.14 | 0.8 | 8 | 735.0 | same-strand | Mur ligase middle domain |
12 | PF07497.14 | 0.9 | 9 | 2328 | same-strand | Rho termination factor, RNA-binding domain |
13 | PF00006.27 | 0.9 | 9 | 2328 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
14 | PF07498.14 | 0.9 | 9 | 2328 | same-strand | Rho termination factor, N-terminal domain |