Protein Information |
Information Type | Description |
---|---|
Protein name | 50S ribosomal protein L24 |
NCBI Accession ID | CP000108.1 |
Organism | Chlorobium chlorochromatii (strain CaD3) |
Left | 2354358 |
Right | 2354627 |
Strand | - |
Nucleotide Sequence | TTGTGCAATATTTTGATACCGTCAAATATGAAAACAGGGATTAAGAAGGTTAAGCTTCATGTAAAGAAAAATGATACGGTAACTGTTATCAGTGGAAACGATAAAGGGAAGATGGGTAAAGTTCTAAAAGTGTTTCCTGTCGCAAGCCGTGTTATTGTAGAGGGAGTTAATATTCGTAAGCGTCATATGCGTCCCCTTCAAGGGCAAACGCAAGGGCGTATTATTGAAAGAGAATTTCCTATTCACTCATCGAACGTGAAGAAAAGCTAA |
Sequence | MCNILIPSNMKTGIKKVKLHVKKNDTVTVISGNDKGKMGKVLKVFPVASRVIVEGVNIRKRHMRPLQGQTQGRIIEREFPIHSSNVKKS |
Source of smORF | Swiss-Prot |
Function | One of two assembly initiator proteins, it binds directly to the 5'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit. {ECO:0000255|HAMAP-Rule:MF_01326}.; One of the proteins that surrounds the polypeptide exit tunnel on the outside of the subunit. {ECO:0000255|HAMAP-Rule:MF_01326}. |
Pubmed ID | |
Domain | CDD:412330,CDD:128978 |
Functional Category | Ribosomal_protein |
Uniprot ID | Q3API4 |
ORF Length (Amino Acid) | 89 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 293329 | 293571 | + | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
2 | 2672861 | 2673103 | - | NZ_CP017305.1 | Chlorobaculum limnaeum |
3 | 2058620 | 2058862 | - | NC_002932.3 | Chlorobaculum tepidum TLS |
4 | 195306 | 195548 | + | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
5 | 2792798 | 2793040 | - | NC_008639.1 | Chlorobium phaeobacteroides DSM 266 |
6 | 2451323 | 2451565 | - | NC_010803.1 | Chlorobium limicola DSM 245 |
7 | 193525 | 193767 | + | NC_007512.1 | Pelodictyon luteolum DSM 273 |
8 | 2242840 | 2243082 | - | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
9 | 1300076 | 1300294 | + | NC_011026.1 | Chloroherpeton thalassium ATCC 35110 |
10 | 1612049 | 1612270 | + | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
11 | 33266 | 33493 | + | NZ_CP053825.1 | Campylobacter armoricus |
12 | 62123 | 62350 | + | NC_012039.1 | Campylobacter lari RM2100 |
13 | 71245 | 71472 | + | NZ_CP053848.1 | Campylobacter ornithocola |
14 | 695435 | 695662 | + | NZ_CP063079.1 | Campylobacter peloridis |
15 | 64504 | 64731 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
16 | 16105 | 16338 | + | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
17 | 4044989 | 4045252 | - | NZ_CP007145.1 | Hymenobacter swuensis DY53 |
18 | 1103476 | 1103700 | - | NZ_LT629973.1 | Akkermansia glycaniphila |
19 | 110312 | 110548 | + | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
20 | 893457 | 893684 | - | NZ_AP021898.1 | Akkermansia muciniphila |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00189.22 | 0.9 | 18 | 1447.5 | same-strand | Ribosomal protein S3, C-terminal domain |
2 | PF07650.19 | 0.9 | 18 | 1447.5 | same-strand | KH domain |
3 | PF00252.20 | 0.9 | 18 | 980.5 | same-strand | Ribosomal protein L16p/L10e |
4 | PF00831.25 | 0.9 | 18 | 755.0 | same-strand | Ribosomal L29 protein |
5 | PF00366.22 | 0.9 | 18 | 447.0 | same-strand | Ribosomal protein S17 |
6 | PF00238.21 | 0.9 | 18 | 60.0 | same-strand | Ribosomal protein L14p/L23e |
7 | PF00673.23 | 1.0 | 20 | 36.0 | same-strand | ribosomal L5P family C-terminus |
8 | PF00281.21 | 1.0 | 20 | 36.0 | same-strand | Ribosomal protein L5 |
9 | PF00253.23 | 0.85 | 17 | 662 | same-strand | Ribosomal protein S14p/S29e |
10 | PF00410.21 | 1.0 | 20 | 872.0 | same-strand | Ribosomal protein S8 |
11 | PF00347.25 | 1.0 | 20 | 1342.0 | same-strand | Ribosomal protein L6 |
12 | PF00861.24 | 1.0 | 20 | 1909.0 | same-strand | Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast |