Result : A7Z2J3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Small, acid-soluble spore protein H (SASP H) |
| NCBI Accession ID | CP000560.2 |
| Organism | Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42) (Bacillus amyloliquefaciens subsp. plantarum) |
| Left | 826606 |
| Right | 826788 |
| Strand | + |
| Nucleotide Sequence | GTGAATACACAGCGTGCGAAAGACATTTCAGAATCCGCCGCCATGGCGTATGTGACGTACGAAGGAGTTCCGATTTATATTCAGCATGTCAACGAAGACAAGGAAACAGCCAGAATTTTTCCGATCGGAAATCCGCAATTTGAGCAGGAAGTGCTGCTTTCTGATTTACAAGAGCATTTTTGA |
| Sequence | MNTQRAKDISESAAMAYVTYEGVPIYIQHVNEDKETARIFPIGNPQFEQEVLLSDLQEHF |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl06949. Profile Description: Small acid-soluble spore protein H family. This model is derived from pfam08141 but has been expanded to include in the seed corresponding proteins from three species of Clostridium. Members of this family should occur only in endospore-forming bacteria, typically with two members per genome, but may be absent from the genomes of some endospore-forming bacteria. SspH (previously designated YfjU) was shown to be expressed specifically in spores of Bacillus subtilis. [Cellular processes, Sporulation and germination] |
| Pubmed ID | 17704766 |
| Domain | CDD:414973 |
| Functional Category | Others |
| Uniprot ID | A7Z2J3 |
| ORF Length (Amino Acid) | 60 |
++ More..
| Conservation Analysis |
No. of Species: 45
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3123721 | 3123903 | - | NZ_CP011937.1 | Bacillus velezensis |
| 2 | 824013 | 824195 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 3 | 2984443 | 2984622 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 4 | 2174148 | 2174330 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 5 | 1112075 | 1112254 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 882601 | 882780 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 2793723 | 2793902 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 8 | 1076494 | 1076673 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 9 | 3132514 | 3132693 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 10 | 2372373 | 2372552 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 11 | 865327 | 865506 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 12 | 863111 | 863290 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 13 | 885629 | 885808 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 14 | 821710 | 821889 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 15 | 4543817 | 4543996 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 16 | 2874032 | 2874217 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 17 | 418160 | 418339 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 18 | 1959657 | 1959836 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 19 | 495985 | 496179 | + | NZ_CP045296.1 | Paenibacillus cellulositrophicus |
| 20 | 5778163 | 5778342 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 21 | 5783807 | 5783986 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 22 | 2252575 | 2252769 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 23 | 2133962 | 2134138 | - | NZ_CP009288.1 | Paenibacillus durus |
| 24 | 2665463 | 2665642 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 25 | 543206 | 543385 | - | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 26 | 1955120 | 1955299 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 27 | 1487661 | 1487840 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 28 | 1620508 | 1620687 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 29 | 776044 | 776238 | + | NZ_CP020028.1 | Paenibacillus kribbensis |
| 30 | 230994 | 231170 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 31 | 1456258 | 1456452 | - | NZ_CP045298.1 | Paenibacillus brasilensis |
| 32 | 2000240 | 2000419 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 33 | 2835445 | 2835624 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 34 | 725079 | 725273 | - | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 35 | 1964080 | 1964262 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 36 | 1665838 | 1666029 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 37 | 2509968 | 2510153 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 38 | 551315 | 551494 | - | NZ_LS483476.1 | Lederbergia lentus |
| 39 | 3929151 | 3929360 | + | NZ_CP033433.1 | Cohnella candidum |
| 40 | 1623534 | 1623713 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 41 | 1657660 | 1657839 | - | NC_011725.1 | Bacillus cereus B4264 |
| 42 | 2703628 | 2703807 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 43 | 1628449 | 1628628 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 44 | 1601282 | 1601461 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 45 | 2596304 | 2596483 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 46 | 1453532 | 1453711 | + | NZ_CP048104.1 | Kroppenstedtia pulmonis |
++ More..