Protein Information |
Information Type | Description |
---|---|
Protein name | 30S ribosomal protein S18 |
NCBI Accession ID | CP000108.1 |
Organism | Chlorobium chlorochromatii (strain CaD3) |
Left | 110910 |
Right | 111188 |
Strand | + |
Nucleotide Sequence | ATGAAACCAAGAGCTACATCATCCCACGGCTATAAAGCACAAGGCAATAAAGCCTTAAATGGAGCGCTTACTTCTAAGAAGAAAGTCTCTAAAAATCAAGTTGTTTTTTTTGACTACCGTGATGAGCGTAAGTTGAAGCGCTTTATTAATGATCAGGGGAAAATTATTCCTCGCCGTATTACAGGCTTATCGGCAAAAGAGCAGAACCTGCTTACCCATTCGGTAAAGTGGGCACGCTTCCTTGCTGTTATTCCTTATGTTGTTGACGAATACAAATAA |
Sequence | MKPRATSSHGYKAQGNKALNGALTSKKKVSKNQVVFFDYRDERKLKRFINDQGKIIPRRITGLSAKEQNLLTHSVKWARFLAVIPYVVDEYK |
Source of smORF | Swiss-Prot |
Function | Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit. {ECO:0000255|HAMAP-Rule:MF_00270}. |
Pubmed ID | |
Domain | CDD:412341 |
Functional Category | Ribosomal_protein |
Uniprot ID | Q3ANR3 |
ORF Length (Amino Acid) | 92 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 123525 | 123803 | + | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
2 | 129983 | 130255 | + | NC_007512.1 | Pelodictyon luteolum DSM 273 |
3 | 130728 | 130991 | + | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
4 | 2629716 | 2629940 | - | NZ_CP017305.1 | Chlorobaculum limnaeum |
5 | 168178 | 168441 | + | NC_010803.1 | Chlorobium limicola DSM 245 |
6 | 2876128 | 2876352 | - | NC_008639.1 | Chlorobium phaeobacteroides DSM 266 |
7 | 2018858 | 2019082 | - | NC_002932.3 | Chlorobaculum tepidum TLS |
8 | 169228 | 169491 | + | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
9 | 762301 | 762573 | - | NC_011026.1 | Chloroherpeton thalassium ATCC 35110 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF12968.9 | 0.89 | 8 | 2995.0 | same-strand | Domain of Unknown Function (DUF3856) |
2 | PF01075.19 | 0.89 | 8 | 1983.5 | same-strand | Glycosyltransferase family 9 (heptosyltransferase) |
3 | PF01250.19 | 1.0 | 9 | 616 | same-strand | Ribosomal protein S6 |
4 | PF00436.27 | 1.0 | 9 | 74 | same-strand | Single-strand binding protein family |
5 | PF03948.16 | 1.0 | 9 | 38 | same-strand | Ribosomal protein L9, C-terminal domain |
6 | PF01281.21 | 0.89 | 8 | 37.5 | same-strand | Ribosomal protein L9, N-terminal domain |
7 | PF03372.25 | 0.78 | 7 | 1240 | same-strand | Endonuclease/Exonuclease/phosphatase family |
8 | PF01409.22 | 0.78 | 7 | 1215 | opposite-strand | tRNA synthetases class II core domain (F) |
9 | PF02912.20 | 0.78 | 7 | 1215 | opposite-strand | Aminoacyl tRNA synthetase class II, N-terminal domain |