Result : Q3ALM2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Photosystem I reaction center subunit XII (PSI-M) |
| NCBI Accession ID | |
| Organism | Synechococcus sp. (strain CC9605) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | METVLSAPEVFIALVVAAHAAVLALRLSISLYEA |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q3ALM2 |
| ORF Length (Amino Acid) | 34 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 27150 | 27254 | - | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 2 | 4251592 | 4251687 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 3 | 3920985 | 3921083 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 4 | 179299 | 179394 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 5 | 487438 | 487533 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 6 | 212880 | 212975 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 7 | 2332514 | 2332609 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 8 | 1516745 | 1516843 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
++ More..