ProsmORF-pred
Result : Q3AJS3
Protein Information
Information Type Description
Protein name 50S ribosomal protein L28
NCBI Accession ID CP000110.1
Organism Synechococcus sp. (strain CC9605)
Left 1320756
Right 1320992
Strand +
Nucleotide Sequence ATGTCACGGGTGTGTCAGCTCACCGGTACTCGCGCCAACAACGGCATGGCTGTGAGCCATTCCCACATCCGCACCAAGAAGCTGCAGCAGGCCAACCTGCAGCAGCGTCGCCTCTGGTGGGCCGAAGGCAACCGCTGGGTGAAGCTTCGCGTCACCACCCGCGCCCTAAAAACTATCCAGAAGAAAGGCCTCGGCGCCTATGCCAAGTCTCTGGGCATTAACCTGGCCAAGATCTGA
Sequence MSRVCQLTGTRANNGMAVSHSHIRTKKLQQANLQQRRLWWAEGNRWVKLRVTTRALKTIQKKGLGAYAKSLGINLAKI
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification]
Pubmed ID
Domain CDD:412338
Functional Category Ribosomal_protein
Uniprot ID Q3AJS3
ORF Length (Amino Acid) 78
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 75
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 641238 641474 + NC_019675.1 Cyanobium gracile PCC 6307
2 847533 847769 - NC_005042.1 Prochlorococcus marinus subsp. marinus str. CCMP1375
3 2921224 2921460 + NC_010296.1 Microcystis aeruginosa NIES-843
4 2056241 2056477 + NC_019689.1 Pleurocapsa sp. PCC 7327
5 981958 982194 - NC_019693.1 Oscillatoria acuminata PCC 6304
6 2553959 2554195 + NZ_AP018202.1 Thermostichus vulcanus NIES-2134
7 2576546 2576782 + NC_004113.1 Thermosynechococcus vestitus BP-1
8 3103818 3104054 - NC_019748.1 Stanieria cyanosphaera PCC 7437
9 1319266 1319502 - NZ_CP021983.2 Halomicronema hongdechloris C2206
10 3627669 3627917 + NC_019776.1 Cyanobacterium aponinum PCC 10605
11 4987001 4987237 + NZ_AP014638.1 Leptolyngbya boryana IAM M-101
12 121297 121533 - NC_019780.1 Dactylococcopsis salina PCC 8305
13 1027946 1028182 + NC_019771.1 Anabaena cylindrica PCC 7122
14 1936427 1936663 - NC_019751.1 Calothrix sp. PCC 6303
15 1250703 1250939 - NZ_CP018092.1 Synechococcus lividus PCC 6715
16 1481508 1481744 + NZ_CP047242.1 Trichormus variabilis 0441
17 1679515 1679751 - NC_014248.1 'Nostoc azollae' 0708
18 5096461 5096697 - NC_014501.1 Gloeothece verrucosa PCC 7822
19 3525408 3525644 + NZ_CP060822.1 Cylindrospermopsis curvispora GIHE-G1
20 1943062 1943298 + NC_019753.1 Crinalium epipsammum PCC 9333
21 3172184 3172420 + NC_011729.1 Gloeothece citriformis PCC 7424
22 2727967 2728203 + NC_009925.1 Acaryochloris marina MBIC11017
23 2033125 2033361 + NC_019695.1 Chroococcidiopsis thermalis PCC 7203
24 3686248 3686484 + NZ_CP031941.1 Nostoc sphaeroides
25 2784672 2784908 + NZ_CP042326.1 Euhalothece natronophila Z-M001
26 4514647 4514883 - NZ_CP024785.1 Nostoc flagelliforme CCNUN1
27 4706129 4706365 + NC_019729.1 Oscillatoria nigro-viridis PCC 7112
28 582324 582560 + NZ_CP054698.1 Nostoc edaphicum CCNP1411
29 561455 561691 + NC_016025.1 Chloracidobacterium thermophilum B
30 2661297 2661542 - NC_022600.1 Gloeobacter kilaueensis JS1
31 1593974 1594210 + NZ_CP060711.1 Thermomonas brevis
32 5249536 5249772 - NZ_AP017422.1 Filimonas lacunae
33 4021886 4022122 - NZ_LT853882.1 Xanthomonas fragariae
34 290353 290589 + NZ_CP007810.1 Xanthomonas oryzae pv. oryzicola
35 4788835 4789071 - NZ_CP072268.1 Xanthomonas euvesicatoria pv. alfalfae
36 2629012 2629248 - NZ_CP018725.1 Xanthomonas vesicatoria ATCC 35937
37 3283250 3283486 - NZ_CP016878.1 Xanthomonas hortorum
38 4049442 4049678 + NZ_CP016172.1 Bordetella flabilis
39 6224445 6224681 + NC_013440.1 Haliangium ochraceum DSM 14365
40 4664622 4664858 - NZ_CP058243.1 Xanthomonas campestris pv. raphani
41 170334 170570 + NZ_CP033326.1 Xanthomonas cucurbitae
42 4634762 4634998 - NZ_CP028127.1 Xanthomonas vasicola pv. vasculorum
43 4869649 4869885 - NZ_CP048044.1 Xanthomonas citri
44 204296 204532 + NZ_CP023406.1 Luteimonas chenhongjianii
45 2416477 2416713 - NZ_CP043476.1 Xanthomonas hyacinthi
46 851006 851242 - NZ_AP018558.1 Hydrogenophilus thermoluteolus
47 254365 254601 + NZ_CP029843.1 Lysobacter maris
48 584054 584290 + NC_004556.1 Xylella fastidiosa Temecula1
49 736365 736601 + NZ_CP053627.1 Xylella taiwanensis
50 567115 567351 - NC_016043.1 Taylorella asinigenitalis MCE3
51 2613496 2613735 + NZ_CP028136.1 Gramella fulva
52 541923 542159 - NZ_CP021060.1 Taylorella equigenitalis
53 3376971 3377207 - NZ_CP010817.1 Myroides profundi
54 2163084 2163320 - NC_017025.1 Flavobacterium indicum GPTSA100-9 = DSM 17447
55 3418753 3418989 + NZ_AP021884.1 Sulfuriferula plumbiphila
56 5320413 5320637 - NZ_CP012159.1 Chondromyces crocatus
57 650386 650610 - NZ_CP016211.1 Minicystis rosea
58 588105 588341 - NZ_CP039934.1 Myroides fluvii
59 2192056 2192292 + NZ_CP029556.1 Lysobacter oculi
60 141120 141356 + NZ_CP046570.1 Xanthomonas albilineans
61 579245 579481 - NZ_CP039456.1 Changchengzhania lutea
62 438073 438306 + NZ_LR134313.1 Neisseria canis
63 417139 417375 - NC_015581.1 Thiomicrospira cyclica ALM1
64 369724 369960 - NZ_CP007030.1 Thiomicrospira aerophila AL3
65 702322 702558 + NC_013959.1 Sideroxydans lithotrophicus ES-1
66 6256210 6256434 + NC_010162.1 Sorangium cellulosum So ce56
67 2182682 2182918 - NZ_AP018721.1 Sulfuritortus calidifontis
68 619409 619645 + NZ_AP018738.1 Ferriphaselus amnicola
69 2459548 2459784 - NC_014394.1 Gallionella capsiferriformans ES-2
70 2649414 2649650 + NC_017857.3 Methylophaga nitratireducenticrescens
71 1194269 1194502 - NC_008825.1 Methylibium petroleiphilum PM1
72 1289529 1289768 - NZ_CP018153.1 Gramella salexigens
73 2388483 2388722 - NC_008571.1 Gramella forsetii KT0803
74 1076915 1077151 + NZ_CP007142.1 Gynuella sunshinyii YC6258
75 2887331 2887570 + NZ_CP016359.1 Gramella flava JLT2011
++ More..