Result : Q3AG27
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S6 |
| NCBI Accession ID | CP000141.1 |
| Organism | Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) |
| Left | 28352 |
| Right | 28642 |
| Strand | + |
| Nucleotide Sequence | ATGCTGCGCCAGTACGAAGTAATGTACATTTTGCATCCGGAGCTTGATGCGGAAAAAACCGAAAGCATTATTGAGAGATTTAAAGGGATGATTGAACAGGAAGGCGGCGAAGTAACCAAAATCGACCGCTGGGGCAAACGGCGTTTTGCCTATGAAATTAAAAAGCTCCGGGAAGGCTATTATGTGGTAATGAACTTTAAAGCCAAAGCGGAAACTGCACAAGAGCTTGACCGGCTTTTAAGAATTTCCGATGATGTTGTGCGGCATATTGTTATTCGGGAAGACAAGTAA |
| Sequence | MLRQYEVMYILHPELDAEKTESIIERFKGMIEQEGGEVTKIDRWGKRRFAYEIKKLREGYYVVMNFKAKAETAQELDRLLRISDDVVRHIVIREDK |
| Source of smORF | Swiss-Prot |
| Function | Binds together with S18 to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00360}. |
| Pubmed ID | 16311624 |
| Domain | CDD:412366 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q3AG27 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 47
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 28352 | 28642 | + | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 2 | 4532488 | 4532775 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 3 | 3589663 | 3589932 | - | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 4 | 4745668 | 4745955 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 5 | 2256835 | 2257122 | - | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 6 | 3057599 | 3057859 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 7 | 193478 | 193765 | + | NZ_CP014176.1 | Clostridium argentinense |
| 8 | 3790763 | 3791053 | - | NZ_CP040924.1 | Clostridium thermarum |
| 9 | 1711861 | 1712151 | - | NZ_CP023671.1 | Clostridium septicum |
| 10 | 2566251 | 2566538 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 11 | 2855763 | 2856053 | - | NZ_CP016786.1 | Clostridium isatidis |
| 12 | 120857 | 121153 | + | NZ_CP017237.1 | Moorella thermoacetica |
| 13 | 1268326 | 1268616 | + | NZ_CP071376.1 | Clostridium gasigenes |
| 14 | 4842879 | 4843169 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 15 | 2768102 | 2768392 | - | NC_015520.1 | Mahella australiensis 50-1 BON |
| 16 | 4596975 | 4597262 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 17 | 6515547 | 6515834 | - | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 18 | 2421944 | 2422228 | - | NZ_LT906477.1 | Clostridium cochlearium |
| 19 | 2121101 | 2121388 | - | NC_013385.1 | Ammonifex degensii KC4 |
| 20 | 4125501 | 4125785 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 21 | 3842161 | 3842445 | - | NZ_CP028842.1 | Clostridium botulinum |
| 22 | 3763967 | 3764257 | + | NZ_CP030775.1 | Clostridium butyricum |
| 23 | 3246272 | 3246556 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 24 | 5924749 | 5925036 | - | NZ_CP043998.1 | Clostridium diolis |
| 25 | 2118748 | 2119035 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 26 | 11787 | 12074 | + | NC_008593.1 | Clostridium novyi NT |
| 27 | 5093132 | 5093419 | - | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 28 | 573589 | 573876 | + | NZ_CP026363.1 | Brevibacillus agri |
| 29 | 6644542 | 6644829 | - | NZ_LR134338.1 | Brevibacillus brevis |
| 30 | 2671360 | 2671647 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 31 | 2765919 | 2766206 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 32 | 2287703 | 2287990 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 33 | 2431379 | 2431666 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 34 | 3077037 | 3077327 | - | NZ_CP014204.2 | Clostridium baratii |
| 35 | 2378619 | 2378906 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 36 | 2325505 | 2325792 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 37 | 2907080 | 2907379 | + | NZ_CP045875.1 | Heliorestis convoluta |
| 38 | 66038 | 66328 | + | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 39 | 6477769 | 6478053 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 40 | 104760 | 105029 | - | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 41 | 4228358 | 4228648 | - | NZ_CP033433.1 | Cohnella candidum |
| 42 | 643357 | 643644 | - | NZ_CP013023.1 | Paenibacillus bovis |
| 43 | 8803755 | 8804039 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 44 | 2528769 | 2529059 | - | NZ_CP041217.1 | Saccharibacillus brassicae |
| 45 | 3654883 | 3655170 | - | NZ_CP015449.1 | Dietzia lutea |
| 46 | 2371596 | 2371889 | - | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 47 | 1586396 | 1586683 | + | NZ_CP027228.1 | Mogibacterium diversum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007503.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06107.13 | 0.85 | 40 | 127.5 | same-strand | Bacterial protein of unknown function (DUF951) |
| 2 | PF00924.20 | 0.66 | 31 | 349 | same-strand | Mechanosensitive ion channel |
| 3 | PF00436.27 | 0.98 | 46 | 21.5 | same-strand | Single-strand binding protein family |
| 4 | PF01084.22 | 0.98 | 46 | 498.5 | same-strand | Ribosomal protein S18 |
++ More..