Result : Q3AAM6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | CP000141.1 |
| Organism | Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) |
| Left | 1777935 |
| Right | 1778168 |
| Strand | - |
| Nucleotide Sequence | ATGACCTTTGAAGAAGCGATGAATAGATTAAACGAGATTGTGGAACGTTTGGAACGGGGAAATGTAGGGTTAGAAGAAAGCTTGGCTCTTTTTGAAGAAGGATTAAAGCTTCACCGTTTTTGCAGCGAAAAGTTGAAAGAGTTAGAATTAAAGTTAGTGGAAGTTCAGGAAGATGAAGCCGGCGAGGTTACTTTTGAGGAAATTGTGGAAATGGAAGATGATTTACCTTTTTAG |
| Sequence | MTFEEAMNRLNEIVERLERGNVGLEESLALFEEGLKLHRFCSEKLKELELKLVEVQEDEAGEVTFEEIVEMEDDLPF |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | 16311624 |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | Q3AAM6 |
| ORF Length (Amino Acid) | 77 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1777935 | 1778168 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 2 | 1658051 | 1658290 | - | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 3 | 2444137 | 2444352 | + | NZ_CP020470.1 | Rhodobacter blasticus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007503.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01728.21 | 0.67 | 2 | 2485.5 | same-strand | FtsJ-like methyltransferase |
| 2 | PF13292.8 | 0.67 | 2 | 1550.5 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
| 3 | PF02779.26 | 0.67 | 2 | 1550.5 | same-strand | Transketolase, pyrimidine binding domain |
| 4 | PF02780.22 | 0.67 | 2 | 1550.5 | same-strand | Transketolase, C-terminal domain |
| 5 | PF00348.19 | 1.0 | 3 | 0 | same-strand | Polyprenyl synthetase |
| 6 | PF02601.17 | 0.67 | 2 | -4.0 | same-strand | Exonuclease VII, large subunit |
| 7 | PF13742.8 | 0.67 | 2 | -4.0 | same-strand | OB-fold nucleic acid binding domain |
| 8 | PF01336.27 | 0.67 | 2 | -4.0 | same-strand | OB-fold nucleic acid binding domain |
| 9 | PF01029.20 | 0.67 | 2 | 3580.5 | same-strand | NusB family |
++ More..