Result : Q3A941
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) |
| NCBI Accession ID | CP000141.1 |
| Organism | Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) |
| Left | 2274839 |
| Right | 2275087 |
| Strand | - |
| Nucleotide Sequence | GTGGATTTTACAATGAGTTTAGTTGCTGGTTTAATTGCTATTGGTGCGGGTATTGCTGTAGGTTTTGGGGCGATAGGTAGCGGTATCGGTCAGGGTATTGCCGCCGGTAAGGCGTTTGAAGCTATGGCCCGGCAGCCGGAAGTCCGGGGTACTGTACAGACATTCTTAATCATCGCCCTTGCTTTCATGGAAACCCTCACCATTTACGGTCTGGTTATCGCCTTTATGCTGCTTAACAAGATGAGCTAA |
| Sequence | MDFTMSLVAGLIAIGAGIAVGFGAIGSGIGQGIAAGKAFEAMARQPEVRGTVQTFLIIALAFMETLTIYGLVIAFMLLNKMS |
| Source of smORF | Swiss-Prot |
| Function | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000255|HAMAP-Rule:MF_01396}.; Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits. {ECO:0000255|HAMAP-Rule:MF_01396}. |
| Pubmed ID | 16311624 |
| Domain | CDD:412393 |
| Functional Category | Others |
| Uniprot ID | Q3A941 |
| ORF Length (Amino Acid) | 82 |
++ More..
| Conservation Analysis |
No. of Species: 59
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2274839 | 2275087 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 2 | 944391 | 944600 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 3 | 2761831 | 2762061 | - | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 4 | 2348487 | 2348741 | - | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 5 | 2462616 | 2462846 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 6 | 3006034 | 3006249 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 7 | 4349514 | 4349720 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 8 | 2439360 | 2439584 | - | NZ_CP017237.1 | Moorella thermoacetica |
| 9 | 3477700 | 3477945 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 10 | 2666194 | 2666421 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 11 | 2566334 | 2566558 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 12 | 2719945 | 2720163 | - | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 13 | 718570 | 718806 | + | NZ_AP019551.1 | Athalassotoga saccharophila |
| 14 | 579996 | 580226 | - | NZ_LR215042.1 | Mycoplasmopsis meleagridis |
| 15 | 2311121 | 2311348 | - | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 16 | 199521 | 199772 | + | NZ_CP014150.1 | Paeniclostridium sordellii |
| 17 | 2400151 | 2400399 | + | NZ_AP018449.1 | Methylomusa anaerophila |
| 18 | 188236 | 188469 | + | NZ_CP034841.1 | Mycoplasmopsis phocirhinis |
| 19 | 205497 | 205766 | + | NC_018664.1 | Gottschalkia acidurici 9a |
| 20 | 430482 | 430697 | - | NZ_LR215036.1 | Mycoplasmopsis citelli |
| 21 | 129470 | 129676 | + | NZ_CP013197.1 | Spiroplasma citri |
| 22 | 1341751 | 1341957 | - | NZ_CP010899.1 | Spiroplasma kunkelii CR2-3x |
| 23 | 843716 | 843922 | - | NZ_CP031088.1 | Spiroplasma phoeniceum P40 |
| 24 | 800030 | 800242 | + | NC_014836.1 | Desulfurispirillum indicum S5 |
| 25 | 52449 | 52682 | - | NZ_LR215037.1 | Mycoplasmopsis maculosa |
| 26 | 147250 | 147486 | + | NZ_LR134523.1 | Peptoniphilus ivorii |
| 27 | 1180404 | 1180610 | + | NZ_CP028103.1 | Fusobacterium varium ATCC 27725 |
| 28 | 1505784 | 1505990 | + | NZ_CP028105.1 | Fusobacterium ulcerans |
| 29 | 276017 | 276250 | - | NZ_LR215043.1 | Mycoplasmopsis columbinasalis |
| 30 | 231997 | 232203 | + | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 31 | 3950127 | 3950339 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 32 | 2767488 | 2767691 | - | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 33 | 614997 | 615200 | + | NZ_AP014657.1 | Mycoplasmopsis arginini |
| 34 | 386053 | 386256 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 35 | 1716438 | 1716683 | - | NC_015673.1 | Corynebacterium resistens DSM 45100 |
| 36 | 2254520 | 2254723 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 37 | 249734 | 249982 | + | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 38 | 250039 | 250287 | + | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 39 | 1789997 | 1790239 | + | NZ_LS483464.1 | Corynebacterium renale |
| 40 | 3417701 | 3417967 | - | NZ_CP014176.1 | Clostridium argentinense |
| 41 | 215703 | 215906 | + | NZ_CP020559.1 | Clostridium formicaceticum |
| 42 | 1428781 | 1428996 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 43 | 230995 | 231198 | + | NZ_CP009687.1 | Clostridium aceticum |
| 44 | 1088426 | 1088677 | + | NZ_CP011545.1 | Corynebacterium testudinoris |
| 45 | 2000351 | 2000569 | + | NZ_LR130778.1 | Petrocella atlantisensis |
| 46 | 1360982 | 1361200 | + | NZ_CP023643.1 | Brochothrix thermosphacta |
| 47 | 2506195 | 2506413 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 48 | 2635953 | 2636171 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 49 | 2611192 | 2611410 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 50 | 2521205 | 2521423 | - | NZ_LT906444.1 | Listeria welshimeri |
| 51 | 676150 | 676374 | + | NZ_CP029256.1 | Christensenella minuta |
| 52 | 1988490 | 1988708 | - | NZ_CP030777.1 | Faecalibacterium prausnitzii |
| 53 | 2470173 | 2470385 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 54 | 1113873 | 1114091 | - | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
| 55 | 4510936 | 4511154 | - | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 56 | 4886607 | 4886831 | - | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 57 | 594393 | 594623 | - | NZ_CP053187.1 | Turicibacter sanguinis |
| 58 | 301264 | 301482 | - | NZ_CP007389.1 | Thermosipho melanesiensis |
| 59 | 574538 | 574756 | + | NC_011653.1 | Thermosipho africanus TCF52B |
| 60 | 2456658 | 2456882 | + | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007503.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00006.27 | 0.85 | 50 | 1496 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
| 2 | PF02874.25 | 0.98 | 58 | 1381.5 | same-strand | ATP synthase alpha/beta family, beta-barrel domain |
| 3 | PF00231.21 | 0.83 | 49 | 2689.0 | same-strand | ATP synthase |
| 4 | PF00306.29 | 0.93 | 55 | 1160.5 | same-strand | ATP synthase alpha/beta chain, C terminal domain |
| 5 | PF00213.20 | 0.88 | 52 | 582 | same-strand | ATP synthase delta (OSCP) subunit |
| 6 | PF00430.20 | 0.92 | 54 | 65.0 | same-strand | ATP synthase B/B' CF(0) |
| 7 | PF00119.22 | 0.85 | 50 | 75 | same-strand | ATP synthase A chain |
++ More..