ProsmORF-pred
Result : Q3A6Y1
Protein Information
Information Type Description
Protein name UPF0235 protein Pcar_0617
NCBI Accession ID CP000142.2
Organism Pelobacter carbinolicus (strain DSM 2380 / NBRC 103641 / GraBd1)
Left 746442
Right 746729
Strand +
Nucleotide Sequence ATGGCGGAATGTCTGTCGCAAACCGATAAGGGCGTTGTGCTCAGTGTCCATGTGCAACCGCGGGCCAGTCGGAATGAATTGGCCGGTTTGCAGGGGGAAAGTCTCAAAATCCGCCTCACCTCACCGCCGGTTGAAGGTGCCGCCAATAAATTGTGCCGGGAATTTCTCGCCAAATTGCTGGGGGTGGCCAAAAGTCGGGTGACCCTCGTGTCCGGTGATAAATCGCGTCATAAACGTCTCCTTATCGAGGGTGTTACTCTCGATGAAGTACGCAATAAACTGCTTTAA
Sequence MAECLSQTDKGVVLSVHVQPRASRNELAGLQGESLKIRLTSPPVEGAANKLCREFLAKLLGVAKSRVTLVSGDKSRHKRLLIEGVTLDEVRNKLL
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl00811. Profile Description: Uncharacterized ACR, YggU family COG1872. hypothetical protein; Validated
Pubmed ID
Domain CDD:412584
Functional Category Others
Uniprot ID Q3A6Y1
ORF Length (Amino Acid) 95
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 32
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 746442 746729 + NC_007498.2 Syntrophotalea carbinolica DSM 2380
2 2773664 2773954 + NZ_CP015519.1 Syntrophotalea acetylenivorans
3 2522565 2522852 - NZ_CP010311.1 Geoalkalibacter subterraneus
4 2681396 2681689 - NZ_CP010802.1 Desulfuromonas soudanensis
5 1378761 1379069 + NC_009483.1 Geobacter uraniireducens Rf4
6 1289079 1289321 - NC_007517.1 Geobacter metallireducens GS-15
7 23904 24185 + NC_008609.1 Pelobacter propionicus DSM 2379
8 922319 922567 - NC_002939.5 Geobacter sulfurreducens PCA
9 1988639 1988893 + NC_011979.1 Geobacter daltonii FRC-32
10 2646716 2647024 + NZ_CP009788.1 Geobacter pickeringii
11 395338 395643 - NC_010814.1 Geobacter lovleyi SZ
12 2668984 2669235 + NZ_CP040098.1 Desulfoglaeba alkanexedens ALDC
13 330070 330348 + NZ_CP045798.1 Thermoanaerosceptrum fracticalcis
14 3055010 3055252 - NZ_AP023213.1 Citrifermentans bremense
15 490981 491232 - NZ_AP013035.1 Thermosulfidibacter takaii ABI70S6
16 1730673 1730915 + NC_011146.1 Citrifermentans bemidjiense Bem
17 3624718 3624957 - NC_021184.1 Desulfoscipio gibsoniae DSM 7213
18 2139730 2139981 + NZ_CP010904.1 Kiritimatiella glycovorans
19 1736443 1736712 - NC_002932.3 Chlorobaculum tepidum TLS
20 4962577 4962885 + NC_008554.1 Syntrophobacter fumaroxidans MPOB
21 1112342 1112590 + NC_013216.1 Desulfofarcimen acetoxidans DSM 771
22 47492 47785 + NC_011026.1 Chloroherpeton thalassium ATCC 35110
23 268065 268316 - NZ_AP012547.1 Sulfuritalea hydrogenivorans sk43H
24 6222483 6222734 + NC_017030.1 Corallococcus coralloides DSM 2259
25 1925090 1925347 - NZ_CP059560.1 Aromatoleum petrolei
26 2200782 2201051 - NZ_CP017305.1 Chlorobaculum limnaeum
27 2653710 2654003 + NZ_CP059467.1 Aromatoleum bremense
28 1030084 1030377 - NC_006513.1 Aromatoleum aromaticum EbN1
29 3888325 3888609 - NZ_CP016210.1 Azoarcus olearius
30 1810246 1810527 + NZ_CP012362.1 Oblitimonas alkaliphila
31 2130065 2130361 + NZ_CP029495.1 Chromobacterium phragmitis
32 4588140 4588436 - NC_005085.1 Chromobacterium violaceum ATCC 12472
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_007498.2
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF02325.19 0.72 23 496 same-strand YGGT family
++ More..