Result : A7X0F7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Na(+)/H(+) antiporter subunit F1 (Mnh complex subunit F1) |
| NCBI Accession ID | AP009324.1 |
| Organism | Staphylococcus aureus (strain Mu3 / ATCC 700698) |
| Left | 990428 |
| Right | 990721 |
| Strand | - |
| Nucleotide Sequence | ATGAATCATAATGTTATTATCGTTATTGCATTAATCATAGTTGTCATTTCTATGTTAGCTATGCTCATTCGCGTTGTGCTAGGCCCATCACTTGCCGATCGTGTTGTCGCATTAGATGCGATTGGTCTTCAATTAATGGCAGTTATAGCATTATTCAGTATTTTATTAAATATTAAATACATGATTGTCGTTATTATGATGATTGGTATATTAGCCTTTTTAGGTACTGCAGTATTCTCTAAATTTATGGACAAAGGTAAGGTGATTGAACATGATCAAAATCATACTGATTAG |
| Sequence | MNHNVIIVIALIIVVISMLAMLIRVVLGPSLADRVVALDAIGLQLMAVIALFSILLNIKYMIVVIMMIGILAFLGTAVFSKFMDKGKVIEHDQNHTD |
| Source of smORF | Swiss-Prot |
| Function | Mnh complex is a Na(+)/H(+) antiporter involved in Na(+) excretion. {ECO:0000250}. |
| Pubmed ID | 17954695 |
| Domain | CDD:415596 |
| Functional Category | Others |
| Uniprot ID | A7X0F7 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 51
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 848527 | 848820 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 920246 | 920539 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 1868209 | 1868451 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 4 | 2111173 | 2111415 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 5 | 1947377 | 1947670 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 6 | 869502 | 869795 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 7 | 1901755 | 1902048 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 8 | 2057825 | 2058118 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 9 | 570590 | 570883 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 10 | 1210539 | 1210832 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 11 | 206333 | 206626 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 12 | 645064 | 645357 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 13 | 1435294 | 1435536 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 14 | 1869646 | 1869939 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 15 | 1382567 | 1382860 | - | NZ_CP027770.1 | Staphylococcus felis |
| 16 | 537911 | 538204 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 17 | 2412445 | 2412738 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 18 | 1974962 | 1975255 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 19 | 1899196 | 1899489 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 20 | 617731 | 617970 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 21 | 738449 | 738742 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 22 | 1994858 | 1995151 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 23 | 1745651 | 1745944 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 24 | 826417 | 826659 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 25 | 969191 | 969445 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 26 | 2142319 | 2142582 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 27 | 1809718 | 1809960 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 28 | 395789 | 396031 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 29 | 1893800 | 1894042 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 30 | 353369 | 353611 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 31 | 787811 | 788059 | - | NZ_CP054482.1 | Macrococcus bohemicus |
| 32 | 718719 | 718967 | - | NZ_CP047361.1 | Macrococcus canis |
| 33 | 1009522 | 1009770 | + | NZ_CP065729.1 | Macrococcus caseolyticus |
| 34 | 1881239 | 1881481 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 35 | 1298655 | 1298906 | + | NZ_CP019573.1 | Abyssicoccus albus |
| 36 | 1659272 | 1659508 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 37 | 3608498 | 3608782 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 38 | 1022938 | 1023174 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 39 | 3204137 | 3204385 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 40 | 3430286 | 3430534 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 41 | 3819487 | 3819723 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 42 | 3981874 | 3982146 | + | NZ_CP053989.1 | Niallia circulans |
| 43 | 3391165 | 3391401 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 44 | 4138786 | 4139067 | - | NZ_AP019400.1 | Cohnella abietis |
| 45 | 3115754 | 3115996 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 46 | 3115367 | 3115609 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 47 | 3045759 | 3046001 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 48 | 3251766 | 3252008 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 49 | 328073 | 328321 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 50 | 3038547 | 3038789 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 51 | 3010848 | 3011090 | - | NZ_CP029364.1 | Bacillus halotolerans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03553.16 | 0.63 | 32 | 2167.0 | opposite-strand | Na+/H+ antiporter family |
| 2 | PF13726.8 | 0.63 | 32 | 2167.0 | opposite-strand | Na+-H+ antiporter family |
| 3 | PF03061.24 | 0.86 | 44 | 1707.0 | opposite-strand | Thioesterase superfamily |
| 4 | PF03334.16 | 1.0 | 51 | -22 | same-strand | Na+/H+ antiporter subunit |
| 5 | PF01899.18 | 1.0 | 51 | 36 | same-strand | Na+/H+ ion antiporter subunit |
| 6 | PF00361.22 | 1.0 | 51 | 1622.5 | same-strand | Proton-conducting membrane transporter |
| 7 | PF00420.26 | 1.0 | 51 | 1990 | same-strand | NADH-ubiquinone/plastoquinone oxidoreductase chain 4L |
| 8 | PF04039.15 | 1.0 | 51 | 2331 | same-strand | Domain related to MnhB subunit of Na+/H+ antiporter |
| 9 | PF13244.8 | 1.0 | 51 | 2756 | same-strand | Domain of unknown function (DUF4040) |
| 10 | PF00662.22 | 1.0 | 51 | 2756 | same-strand | NADH-Ubiquinone oxidoreductase (complex I), chain 5 N-terminus |
++ More..