Protein Information |
Information Type | Description |
---|---|
Protein name | Flagellar transcriptional regulator FlhD |
NCBI Accession ID | CP000150.1 |
Organism | Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383) |
Left | 1311046 |
Right | 1311342 |
Strand | - |
Nucleotide Sequence | ATGTGGGAATTGAACATGTCTTATCTGTGGCTTGCGCAGCGACTGCTGCAGTCGGATCGCGCATCGGGCATGTTCCGCCTGGGCGTGACTGCTGACGTTGCCGCTGCGCTGGCCGCGTTGTCGATGAAGCAGATGAACGATCTTGCGTCGGCGGGGCAACTGATCTGCGCACTGCGGCCGAGCCGGTACGGCGTGCTGTCGGCGTTGACCCGCGCGACGCCGCCGGTCGATCTCGTGCGCGTGCATACCGCGATGGCGCTGGCCGGCCTCGCGCTTCCAGACGAGGAAACATCGTGA |
Sequence | MWELNMSYLWLAQRLLQSDRASGMFRLGVTADVAAALAALSMKQMNDLASAGQLICALRPSRYGVLSALTRATPPVDLVRVHTAMALAGLALPDEETS |
Source of smORF | Swiss-Prot |
Function | Functions in complex with FlhC as a master transcriptional regulator that regulates transcription of several flagellar and non-flagellar operons by binding to their promoter region. Activates expression of class 2 flagellar genes, including fliA, which is a flagellum-specific sigma factor that turns on the class 3 genes. Also regulates genes whose products function in a variety of physiological pathways. {ECO:0000255|HAMAP-Rule:MF_00725}. |
Pubmed ID | |
Domain | CDD:414271 |
Functional Category | DNA-binding |
Uniprot ID | Q39LF7 |
ORF Length (Amino Acid) | 98 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1311046 | 1311342 | - | NC_007509.1 | Burkholderia lata |
2 | 359453 | 359734 | + | NZ_CP013402.1 | Burkholderia metallica |
3 | 2367768 | 2368022 | - | NZ_CP013400.1 | Burkholderia seminalis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02518.28 | 1.0 | 3 | 798 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
2 | PF05280.13 | 1.0 | 3 | -3 | same-strand | Flagellar transcriptional activator (FlhC) |
3 | PF00072.26 | 1.0 | 3 | 575.0 | opposite-strand | Response regulator receiver domain |
4 | PF00196.21 | 1.0 | 3 | 445 | opposite-strand | Bacterial regulatory proteins, luxR family |
5 | PF13185.8 | 0.67 | 2 | 1177.5 | opposite-strand | GAF domain |
6 | PF00512.27 | 1.0 | 3 | 1165 | opposite-strand | His Kinase A (phospho-acceptor) domain |