Result : Q38XT9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | CR936503.1 |
| Organism | Lactobacillus sakei subsp. sakei (strain 23K) |
| Left | 682873 |
| Right | 683130 |
| Strand | + |
| Nucleotide Sequence | ATGATTGTATATCCTTCAATTGATAAGTTACTAGAAAATGTTAACTCACGCTATTCATTAGCCGTTTTAGCAAGCAAGCGAGCACATCAAATCGAAGCTGGCGATTTGAAAATGTTATCAGAATACAAATCACCTAAAACCGTAGGGATGGCAATGGAAGAAATTGCTGCTGGCAATGTAACCATTGATCCTGATTCATTGATGCTTGAAAAAGATGCTGAAAAAATGGATAAGCTTTCTCAAAAAGATGGCGAATAA |
| Sequence | MIVYPSIDKLLENVNSRYSLAVLASKRAHQIEAGDLKMLSEYKSPKTVGMAMEEIAAGNVTIDPDSLMLEKDAEKMDKLSQKDGE |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | 16273110 |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | Q38XT9 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 21
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1480531 | 1480788 | + | NZ_CP046037.1 | Latilactobacillus sakei |
| 2 | 1268691 | 1268948 | - | NZ_CP045007.1 | Latilactobacillus graminis |
| 3 | 213447 | 213704 | + | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 4 | 1586946 | 1587194 | - | NC_014334.2 | Lacticaseibacillus paracasei |
| 5 | 1564315 | 1564563 | - | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 6 | 1568473 | 1568721 | - | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 7 | 676325 | 676579 | - | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 8 | 1724053 | 1724313 | - | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 9 | 1070297 | 1070548 | - | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 10 | 404682 | 404969 | + | NZ_CP031513.1 | Bombilactobacillus bombi |
| 11 | 848705 | 848959 | + | NZ_CP017996.1 | Companilactobacillus crustorum |
| 12 | 1537770 | 1538024 | - | NZ_CP012559.1 | Companilactobacillus heilongjiangensis |
| 13 | 1382978 | 1383235 | - | NZ_CP049366.1 | Companilactobacillus pabuli |
| 14 | 1090769 | 1091023 | + | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 15 | 992898 | 993155 | + | NZ_CP040736.1 | Companilactobacillus futsaii |
| 16 | 1161267 | 1161518 | - | NZ_CP024610.1 | Lactobacillus terrae |
| 17 | 1730598 | 1730852 | + | NZ_CP019323.1 | Companilactobacillus allii |
| 18 | 1269304 | 1269522 | - | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 19 | 830870 | 831079 | + | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 20 | 610721 | 610951 | + | NZ_CP027563.1 | Weissella confusa |
| 21 | 1230464 | 1230688 | - | NZ_CP017326.1 | Weissella soli |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP012034.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02463.21 | 1.0 | 21 | 1384 | same-strand | RecF/RecN/SMC N terminal domain |
| 2 | PF13476.8 | 0.81 | 17 | 1384 | same-strand | AAA domain |
| 3 | PF00625.23 | 1.0 | 21 | 5 | same-strand | Guanylate kinase |
| 4 | PF17764.3 | 0.9 | 19 | 1308 | same-strand | 3'DNA-binding domain (3'BD) |
| 5 | PF18074.3 | 0.9 | 19 | 1308 | same-strand | Primosomal protein N C-terminal domain |
| 6 | PF04851.17 | 0.9 | 19 | 1308 | same-strand | Type III restriction enzyme, res subunit |
| 7 | PF00270.31 | 0.9 | 19 | 1308 | same-strand | DEAD/DEAH box helicase |
| 8 | PF18319.3 | 0.9 | 19 | 1308 | same-strand | PriA DNA helicase Cys-rich region (CRR) domain |
| 9 | PF00551.21 | 0.9 | 19 | 3743 | same-strand | Formyl transferase |
| 10 | PF02911.20 | 0.9 | 19 | 3743 | same-strand | Formyl transferase, C-terminal domain |
| 11 | PF01189.19 | 0.9 | 19 | 4689 | same-strand | 16S rRNA methyltransferase RsmB/F |
| 12 | PF01029.20 | 0.86 | 18 | 4689.5 | same-strand | NusB family |
| 13 | PF17125.7 | 0.86 | 18 | 4355.5 | same-strand | N-terminal domain of 16S rRNA methyltransferase RsmF |
| 14 | PF13672.8 | 0.9 | 19 | 6040 | same-strand | Protein phosphatase 2C |
| 15 | PF07228.14 | 0.76 | 16 | 5028.0 | same-strand | Stage II sporulation protein E (SpoIIE) |
| 16 | PF01728.21 | 0.62 | 13 | 2831.5 | same-strand | FtsJ-like methyltransferase |
++ More..