Protein Information |
Information Type | Description |
---|---|
Protein name | UPF0298 protein LCA_1075 |
NCBI Accession ID | CR936503.1 |
Organism | Lactobacillus sakei subsp. sakei (strain 23K) |
Left | 1069555 |
Right | 1069845 |
Strand | - |
Nucleotide Sequence | ATGGCATTAGAAATGACGCAACGACAAGGCATTGTTGTTTGGCTGTATTCATTACGGCAAGTCAAACAATTGCGACGTTACGGACTTGTGTATTATACGTCTAAACGAATGAAATACGTTTATTTATACGTTGATGCGGACCAAGCACCGGCGGTTATCGAACGATTAAAGAAACTACACTATGTTAAACGAGTAACGCGTTCGCAACGCCCCATGCTCGATATGGAATTTGGCGCATTAGCCGAATTAGCGAATCAAGAGACCGCTACTAAAGCGGCATTAAAGGAGTAA |
Sequence | MALEMTQRQGIVVWLYSLRQVKQLRRYGLVYYTSKRMKYVYLYVDADQAPAVIERLKKLHYVKRVTRSQRPMLDMEFGALAELANQETATKAALKE |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl23792. Profile Description: Uncharacterized protein conserved in bacteria (DUF2129). hypothetical protein; Provisional |
Pubmed ID | 16273110 |
Domain | CDD:420011 |
Functional Category | Others |
Uniprot ID | Q38WQ5 |
ORF Length (Amino Acid) | 96 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1877694 | 1877984 | - | NZ_CP046037.1 | Latilactobacillus sakei |
2 | 337316 | 337606 | + | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
3 | 1123366 | 1123656 | - | NZ_CP045007.1 | Latilactobacillus graminis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00383.25 | 1.0 | 3 | 2933 | same-strand | Cytidine and deoxycytidylate deaminase zinc-binding region |
2 | PF12836.9 | 1.0 | 3 | 2191 | same-strand | Helix-hairpin-helix motif |
3 | PF00633.25 | 1.0 | 3 | 2191 | same-strand | Helix-hairpin-helix motif |
4 | PF13180.8 | 1.0 | 3 | 1068 | same-strand | PDZ domain |
5 | PF01467.28 | 1.0 | 3 | 572 | same-strand | Cytidylyltransferase-like |
6 | PF03602.17 | 1.0 | 3 | 6 | same-strand | Conserved hypothetical protein 95 |
7 | PF14504.8 | 1.0 | 3 | 24 | same-strand | CAP-associated N-terminal |
8 | PF01098.21 | 1.0 | 3 | 1123 | same-strand | Cell cycle protein |
9 | PF07408.13 | 1.0 | 3 | 2319 | same-strand | Protein of unknown function (DUF1507) |
10 | PF00009.29 | 1.0 | 3 | 2720 | same-strand | Elongation factor Tu GTP binding domain |
11 | PF00679.26 | 1.0 | 3 | 2720 | same-strand | Elongation factor G C-terminus |
12 | PF01926.25 | 1.0 | 3 | 2720 | same-strand | 50S ribosome-binding GTPase |
13 | PF03144.27 | 1.0 | 3 | 2720 | same-strand | Elongation factor Tu domain 2 |
14 | PF00459.27 | 1.0 | 3 | 4707 | same-strand | Inositol monophosphatase family |