Result : Q38WQ5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0298 protein LCA_1075 |
| NCBI Accession ID | CR936503.1 |
| Organism | Lactobacillus sakei subsp. sakei (strain 23K) |
| Left | 1069555 |
| Right | 1069845 |
| Strand | - |
| Nucleotide Sequence | ATGGCATTAGAAATGACGCAACGACAAGGCATTGTTGTTTGGCTGTATTCATTACGGCAAGTCAAACAATTGCGACGTTACGGACTTGTGTATTATACGTCTAAACGAATGAAATACGTTTATTTATACGTTGATGCGGACCAAGCACCGGCGGTTATCGAACGATTAAAGAAACTACACTATGTTAAACGAGTAACGCGTTCGCAACGCCCCATGCTCGATATGGAATTTGGCGCATTAGCCGAATTAGCGAATCAAGAGACCGCTACTAAAGCGGCATTAAAGGAGTAA |
| Sequence | MALEMTQRQGIVVWLYSLRQVKQLRRYGLVYYTSKRMKYVYLYVDADQAPAVIERLKKLHYVKRVTRSQRPMLDMEFGALAELANQETATKAALKE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23792. Profile Description: Uncharacterized protein conserved in bacteria (DUF2129). hypothetical protein; Provisional |
| Pubmed ID | 16273110 |
| Domain | CDD:420011 |
| Functional Category | Others |
| Uniprot ID | Q38WQ5 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1877694 | 1877984 | - | NZ_CP046037.1 | Latilactobacillus sakei |
| 2 | 337316 | 337606 | + | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 3 | 1123366 | 1123656 | - | NZ_CP045007.1 | Latilactobacillus graminis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP046037.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00383.25 | 1.0 | 3 | 2933 | same-strand | Cytidine and deoxycytidylate deaminase zinc-binding region |
| 2 | PF12836.9 | 1.0 | 3 | 2191 | same-strand | Helix-hairpin-helix motif |
| 3 | PF00633.25 | 1.0 | 3 | 2191 | same-strand | Helix-hairpin-helix motif |
| 4 | PF13180.8 | 1.0 | 3 | 1068 | same-strand | PDZ domain |
| 5 | PF01467.28 | 1.0 | 3 | 572 | same-strand | Cytidylyltransferase-like |
| 6 | PF03602.17 | 1.0 | 3 | 6 | same-strand | Conserved hypothetical protein 95 |
| 7 | PF14504.8 | 1.0 | 3 | 24 | same-strand | CAP-associated N-terminal |
| 8 | PF01098.21 | 1.0 | 3 | 1123 | same-strand | Cell cycle protein |
| 9 | PF07408.13 | 1.0 | 3 | 2319 | same-strand | Protein of unknown function (DUF1507) |
| 10 | PF00009.29 | 1.0 | 3 | 2720 | same-strand | Elongation factor Tu GTP binding domain |
| 11 | PF00679.26 | 1.0 | 3 | 2720 | same-strand | Elongation factor G C-terminus |
| 12 | PF01926.25 | 1.0 | 3 | 2720 | same-strand | 50S ribosome-binding GTPase |
| 13 | PF03144.27 | 1.0 | 3 | 2720 | same-strand | Elongation factor Tu domain 2 |
| 14 | PF00459.27 | 1.0 | 3 | 4707 | same-strand | Inositol monophosphatase family |
++ More..