Result : Q38WQ2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0358 protein LCA_1078 |
| NCBI Accession ID | CR936503.1 |
| Organism | Lactobacillus sakei subsp. sakei (strain 23K) |
| Left | 1072164 |
| Right | 1072460 |
| Strand | - |
| Nucleotide Sequence | ATGATGATTAAACAAGAAACAATCGGGTATATGACTTTAAAATCAGACGCAGCTAAAATTGAAGCGTTATTGACGAAGCAATTCGACGCGCTTTGTTTAAGTCAATGTCCCATCATTGAAGAAATTATTGATACACAACTGTTTGGTTTTACAAAAGAAGTTGATTTTGCCAAAAGAGTTCGGTTAATTAGTGACCAAGAAGGATCGCAATTAGTAAATGAACTTGAAACGCGTATTAATCAACTTTATTTAGAGATTTATCAAACGCAAGCTCAGAATGAAGTTCATAGAAATTAG |
| Sequence | MMIKQETIGYMTLKSDAAKIEALLTKQFDALCLSQCPIIEEIIDTQLFGFTKEVDFAKRVRLISDQEGSQLVNELETRINQLYLEIYQTQAQNEVHRN |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl26898. Profile Description: Protein of unknown function (DUF1507). hypothetical protein; Provisional |
| Pubmed ID | 16273110 |
| Domain | CDD:421409 |
| Functional Category | Others |
| Uniprot ID | Q38WQ2 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1880303 | 1880599 | - | NZ_CP046037.1 | Latilactobacillus sakei |
| 2 | 334706 | 334999 | + | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP046037.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01467.28 | 1.0 | 2 | 3180.0 | same-strand | Cytidylyltransferase-like |
| 2 | PF03602.17 | 1.0 | 2 | 2613.5 | same-strand | Conserved hypothetical protein 95 |
| 3 | PF09902.11 | 1.0 | 2 | 2318.0 | same-strand | Uncharacterized protein conserved in bacteria (DUF2129) |
| 4 | PF14504.8 | 1.0 | 2 | 1208.0 | same-strand | CAP-associated N-terminal |
| 5 | PF01098.21 | 1.0 | 2 | 9.0 | same-strand | Cell cycle protein |
| 6 | PF00009.29 | 1.0 | 2 | 115.5 | same-strand | Elongation factor Tu GTP binding domain |
| 7 | PF00679.26 | 1.0 | 2 | 115.5 | same-strand | Elongation factor G C-terminus |
| 8 | PF01926.25 | 1.0 | 2 | 115.5 | same-strand | 50S ribosome-binding GTPase |
| 9 | PF03144.27 | 1.0 | 2 | 115.5 | same-strand | Elongation factor Tu domain 2 |
| 10 | PF00459.27 | 1.0 | 2 | 2099.5 | same-strand | Inositol monophosphatase family |
| 11 | PF05256.14 | 1.0 | 2 | 2911.0 | same-strand | Uncharacterised protein family (UPF0223) |
| 12 | PF07992.16 | 1.0 | 2 | 3349.0 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 13 | PF02852.24 | 1.0 | 2 | 3349.0 | same-strand | Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain |
| 14 | PF00070.29 | 1.0 | 2 | 3349.0 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 15 | PF13738.8 | 1.0 | 2 | 3349.0 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 16 | PF00198.25 | 1.0 | 2 | 4763.0 | same-strand | 2-oxoacid dehydrogenases acyltransferase (catalytic domain) |
| 17 | PF00364.24 | 1.0 | 2 | 4763.0 | same-strand | Biotin-requiring enzyme |
| 18 | PF02817.19 | 1.0 | 2 | 4763.0 | same-strand | e3 binding domain |
++ More..