Protein Information |
Information Type | Description |
---|---|
Protein name | UPF0358 protein LCA_1078 |
NCBI Accession ID | CR936503.1 |
Organism | Lactobacillus sakei subsp. sakei (strain 23K) |
Left | 1072164 |
Right | 1072460 |
Strand | - |
Nucleotide Sequence | ATGATGATTAAACAAGAAACAATCGGGTATATGACTTTAAAATCAGACGCAGCTAAAATTGAAGCGTTATTGACGAAGCAATTCGACGCGCTTTGTTTAAGTCAATGTCCCATCATTGAAGAAATTATTGATACACAACTGTTTGGTTTTACAAAAGAAGTTGATTTTGCCAAAAGAGTTCGGTTAATTAGTGACCAAGAAGGATCGCAATTAGTAAATGAACTTGAAACGCGTATTAATCAACTTTATTTAGAGATTTATCAAACGCAAGCTCAGAATGAAGTTCATAGAAATTAG |
Sequence | MMIKQETIGYMTLKSDAAKIEALLTKQFDALCLSQCPIIEEIIDTQLFGFTKEVDFAKRVRLISDQEGSQLVNELETRINQLYLEIYQTQAQNEVHRN |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl26898. Profile Description: Protein of unknown function (DUF1507). hypothetical protein; Provisional |
Pubmed ID | 16273110 |
Domain | CDD:421409 |
Functional Category | Others |
Uniprot ID | Q38WQ2 |
ORF Length (Amino Acid) | 98 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1880303 | 1880599 | - | NZ_CP046037.1 | Latilactobacillus sakei |
2 | 334706 | 334999 | + | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01467.28 | 1.0 | 2 | 3180.0 | same-strand | Cytidylyltransferase-like |
2 | PF03602.17 | 1.0 | 2 | 2613.5 | same-strand | Conserved hypothetical protein 95 |
3 | PF09902.11 | 1.0 | 2 | 2318.0 | same-strand | Uncharacterized protein conserved in bacteria (DUF2129) |
4 | PF14504.8 | 1.0 | 2 | 1208.0 | same-strand | CAP-associated N-terminal |
5 | PF01098.21 | 1.0 | 2 | 9.0 | same-strand | Cell cycle protein |
6 | PF00009.29 | 1.0 | 2 | 115.5 | same-strand | Elongation factor Tu GTP binding domain |
7 | PF00679.26 | 1.0 | 2 | 115.5 | same-strand | Elongation factor G C-terminus |
8 | PF01926.25 | 1.0 | 2 | 115.5 | same-strand | 50S ribosome-binding GTPase |
9 | PF03144.27 | 1.0 | 2 | 115.5 | same-strand | Elongation factor Tu domain 2 |
10 | PF00459.27 | 1.0 | 2 | 2099.5 | same-strand | Inositol monophosphatase family |
11 | PF05256.14 | 1.0 | 2 | 2911.0 | same-strand | Uncharacterised protein family (UPF0223) |
12 | PF07992.16 | 1.0 | 2 | 3349.0 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
13 | PF02852.24 | 1.0 | 2 | 3349.0 | same-strand | Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain |
14 | PF00070.29 | 1.0 | 2 | 3349.0 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
15 | PF13738.8 | 1.0 | 2 | 3349.0 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
16 | PF00198.25 | 1.0 | 2 | 4763.0 | same-strand | 2-oxoacid dehydrogenases acyltransferase (catalytic domain) |
17 | PF00364.24 | 1.0 | 2 | 4763.0 | same-strand | Biotin-requiring enzyme |
18 | PF02817.19 | 1.0 | 2 | 4763.0 | same-strand | e3 binding domain |