Result : Q38VU9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | CR936503.1 |
| Organism | Lactobacillus sakei subsp. sakei (strain 23K) |
| Left | 1349170 |
| Right | 1349448 |
| Strand | + |
| Nucleotide Sequence | ATGCAAAAAGCAGTCCAATTAGATGTATTTGGCCGAGTTCAAGGTGTCGGCTTCCGCTGGACAACTAAGCTGGTGGCCGATCGATTAGGGATTACTGGCACCGTCTCTAACCAACCCGATGGTTCTGTCAAAATTATCGCAATGGGCCCCGATGCCATTTTGGAACAGTTCATTGGCGCCGTTAAAGCGTCTCCGACCCCTAGTGGGCGCGTTGATCGTGTTGTTCAAACACCCTTGCAAGATGTGTCAGCGTGTCATAAATTTTCAGTTGTCGGTTGA |
| Sequence | MQKAVQLDVFGRVQGVGFRWTTKLVADRLGITGTVSNQPDGSVKIIAMGPDAILEQFIGAVKASPTPSGRVDRVVQTPLQDVSACHKFSVVG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | 16273110 |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | Q38VU9 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 24
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 220388 | 220666 | + | NZ_CP046037.1 | Latilactobacillus sakei |
| 2 | 952059 | 952337 | + | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 3 | 609069 | 609347 | - | NZ_CP045007.1 | Latilactobacillus graminis |
| 4 | 1115303 | 1115578 | + | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 5 | 755542 | 755772 | - | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 6 | 864667 | 864900 | - | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 7 | 941320 | 941580 | - | NZ_CP065211.1 | Enterococcus lactis |
| 8 | 1435026 | 1435286 | + | NZ_AP018549.1 | Lactobacillus paragasseri |
| 9 | 1392361 | 1392621 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 10 | 1998398 | 1998658 | + | NZ_CP018061.1 | Enterococcus mundtii |
| 11 | 1285331 | 1285606 | + | NZ_CP044499.1 | Lapidilactobacillus dextrinicus |
| 12 | 1442850 | 1443110 | + | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 13 | 779331 | 779591 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 14 | 689344 | 689604 | - | NZ_CP023074.1 | Enterococcus thailandicus |
| 15 | 1834955 | 1835227 | - | NZ_CP012294.1 | Pediococcus damnosus |
| 16 | 697582 | 697836 | - | NZ_CP039712.1 | Vagococcus zengguangii |
| 17 | 770510 | 770785 | - | NZ_CP047141.1 | Ligilactobacillus animalis |
| 18 | 1529746 | 1530024 | - | NZ_CP023011.2 | Enterococcus hirae |
| 19 | 1410319 | 1410549 | + | NZ_CP012047.1 | Tetragenococcus halophilus |
| 20 | 2358409 | 2358681 | - | NZ_CP049887.1 | Vagococcus hydrophili |
| 21 | 1433309 | 1433539 | + | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 22 | 77555 | 77830 | + | NZ_CP027563.1 | Weissella confusa |
| 23 | 1139571 | 1139846 | + | NZ_CP045530.1 | Limosilactobacillus pontis |
| 24 | 1778348 | 1778602 | - | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP046037.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00588.21 | 0.88 | 21 | 124 | opposite-strand | SpoU rRNA Methylase family |
| 2 | PF08032.14 | 0.88 | 21 | 124 | opposite-strand | RNA 2'-O ribose methyltransferase substrate binding |
| 3 | PF02096.22 | 0.92 | 22 | 91.5 | same-strand | 60Kd inner membrane protein |
++ More..