Protein Information |
Information Type | Description |
---|---|
Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
NCBI Accession ID | CR936503.1 |
Organism | Lactobacillus sakei subsp. sakei (strain 23K) |
Left | 1349170 |
Right | 1349448 |
Strand | + |
Nucleotide Sequence | ATGCAAAAAGCAGTCCAATTAGATGTATTTGGCCGAGTTCAAGGTGTCGGCTTCCGCTGGACAACTAAGCTGGTGGCCGATCGATTAGGGATTACTGGCACCGTCTCTAACCAACCCGATGGTTCTGTCAAAATTATCGCAATGGGCCCCGATGCCATTTTGGAACAGTTCATTGGCGCCGTTAAAGCGTCTCCGACCCCTAGTGGGCGCGTTGATCGTGTTGTTCAAACACCCTTGCAAGATGTGTCAGCGTGTCATAAATTTTCAGTTGTCGGTTGA |
Sequence | MQKAVQLDVFGRVQGVGFRWTTKLVADRLGITGTVSNQPDGSVKIIAMGPDAILEQFIGAVKASPTPSGRVDRVVQTPLQDVSACHKFSVVG |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
Pubmed ID | 16273110 |
Domain | CDD:412440 |
Functional Category | Others |
Uniprot ID | Q38VU9 |
ORF Length (Amino Acid) | 92 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 220388 | 220666 | + | NZ_CP046037.1 | Latilactobacillus sakei |
2 | 952059 | 952337 | + | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
3 | 609069 | 609347 | - | NZ_CP045007.1 | Latilactobacillus graminis |
4 | 1115303 | 1115578 | + | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
5 | 755542 | 755772 | - | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
6 | 864667 | 864900 | - | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
7 | 941320 | 941580 | - | NZ_CP065211.1 | Enterococcus lactis |
8 | 1435026 | 1435286 | + | NZ_AP018549.1 | Lactobacillus paragasseri |
9 | 1392361 | 1392621 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
10 | 1998398 | 1998658 | + | NZ_CP018061.1 | Enterococcus mundtii |
11 | 1285331 | 1285606 | + | NZ_CP044499.1 | Lapidilactobacillus dextrinicus |
12 | 1442850 | 1443110 | + | NZ_CP059276.1 | Lactobacillus taiwanensis |
13 | 779331 | 779591 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
14 | 689344 | 689604 | - | NZ_CP023074.1 | Enterococcus thailandicus |
15 | 1834955 | 1835227 | - | NZ_CP012294.1 | Pediococcus damnosus |
16 | 697582 | 697836 | - | NZ_CP039712.1 | Vagococcus zengguangii |
17 | 770510 | 770785 | - | NZ_CP047141.1 | Ligilactobacillus animalis |
18 | 1529746 | 1530024 | - | NZ_CP023011.2 | Enterococcus hirae |
19 | 1410319 | 1410549 | + | NZ_CP012047.1 | Tetragenococcus halophilus |
20 | 2358409 | 2358681 | - | NZ_CP049887.1 | Vagococcus hydrophili |
21 | 1433309 | 1433539 | + | NZ_CP018180.1 | Liquorilactobacillus nagelii |
22 | 77555 | 77830 | + | NZ_CP027563.1 | Weissella confusa |
23 | 1139571 | 1139846 | + | NZ_CP045530.1 | Limosilactobacillus pontis |
24 | 1778348 | 1778602 | - | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00588.21 | 0.88 | 21 | 124 | opposite-strand | SpoU rRNA Methylase family |
2 | PF08032.14 | 0.88 | 21 | 124 | opposite-strand | RNA 2'-O ribose methyltransferase substrate binding |
3 | PF02096.22 | 0.92 | 22 | 91.5 | same-strand | 60Kd inner membrane protein |