Result : Q38HX3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 4-hydroxyphenylacetate decarboxylase small subunit (HPA decarboxylase small subunit) (EC 4.1.1.83) (4-hydroxyphenylacetate decarboxylase gamma subunit) (p-hydroxyphenylacetate decarboxylase small subunit) |
| NCBI Accession ID | DQ227741.1 |
| Organism | Clostridium scatologenes |
| Left | 2826 |
| Right | 3086 |
| Strand | + |
| Nucleotide Sequence | ATGCGCCACTATGATTGTAAAAATTATATAAATTTAGATTGTGAAAAAGGTCTTTGTGCACTAACAAAGGGAATGGTTCCTATTGATGGTGAAGGAAGTGAAGCTTGCCCTAATTTCAAACCAGCTGAAAAATGCGGAAATTGCAAAAATTTTTGTAATCCGGATAAATACGGATTGGGAACATGTACAGGCTTAGAAAAAGAAAATTGGGCATATGCTACTTGTGGTGCTTCTGCATGTCCTAGTTATAAAGCAGAATAG |
| Sequence | MRHYDCKNYINLDCEKGLCALTKGMVPIDGEGSEACPNFKPAEKCGNCKNFCNPDKYGLGTCTGLEKENWAYATCGASACPSYKAE |
| Source of smORF | Swiss-Prot |
| Function | Component of the HPA decarboxylase that decarboxylates phenylacetates with a hydroxyl group in the p-position. Active toward 4-hydroxyphenylacetate and 3,4-dihydroxyphenylacetate, forming 4-methylphenol and 4-methylcatechol, respectively. Is likely involved in the catabolism of aromatic amino acids such as tyrosine fermentation. 4-methylphenol (p-cresol) formation provides metabolic toxicity, which allows an active suppression of other microbes and may provide growth advantages for the producers in highly competitive environments (Pubmed:16878993). The small subunit is essential for enzymatic activity of HPA decarboxylase, and seems also involved in the regulation of the enzyme oligomeric state and catalytic activity (By similarity). {ECO:0000250|UniProtKB:Q84F15, ECO:0000269|Pubmed:16878993}. |
| Pubmed ID | 16878993 21823587 |
| Domain | CDD:408311,CDD:411304,CDD:408452 |
| Functional Category | Metal-binding |
| Uniprot ID | Q38HX3 |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5460231 | 5460491 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 2 | 4414187 | 4414447 | - | NZ_CP020953.1 | Clostridium drakei |
| 3 | 3546201 | 3546461 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 4 | 1927818 | 1928078 | - | NZ_CP032416.1 | Clostridium fermenticellae |
| 5 | 3148223 | 3148483 | + | NZ_CP048649.1 | Aminipila butyrica |
| 6 | 2541921 | 2542181 | + | NZ_CP043998.1 | Clostridium diolis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP009933.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02901.17 | 1.0 | 6 | 36.5 | same-strand | Pyruvate formate lyase-like |
| 2 | PF01228.23 | 1.0 | 6 | 36.5 | same-strand | Glycine radical |
| 3 | PF04055.23 | 1.0 | 6 | 10.0 | same-strand | Radical SAM superfamily |
| 4 | PF13353.8 | 0.83 | 5 | 10 | same-strand | 4Fe-4S single cluster domain |
| 5 | PF12838.9 | 1.0 | 6 | 15.0 | same-strand | 4Fe-4S dicluster domain |
| 6 | PF00392.23 | 0.67 | 4 | 2664.5 | same-strand | Bacterial regulatory proteins, gntR family |
++ More..