| Protein name |
4-hydroxyphenylacetate decarboxylase small subunit (HPA decarboxylase small subunit) (EC 4.1.1.83) (4-hydroxyphenylacetate decarboxylase gamma subunit) (p-hydroxyphenylacetate decarboxylase small subunit) |
| NCBI Accession ID |
DQ227741.1 |
| Organism |
Clostridium scatologenes |
| Left |
2826 |
| Right |
3086 |
| Strand |
+ |
| Nucleotide Sequence |
ATGCGCCACTATGATTGTAAAAATTATATAAATTTAGATTGTGAAAAAGGTCTTTGTGCACTAACAAAGGGAATGGTTCCTATTGATGGTGAAGGAAGTGAAGCTTGCCCTAATTTCAAACCAGCTGAAAAATGCGGAAATTGCAAAAATTTTTGTAATCCGGATAAATACGGATTGGGAACATGTACAGGCTTAGAAAAAGAAAATTGGGCATATGCTACTTGTGGTGCTTCTGCATGTCCTAGTTATAAAGCAGAATAG |
| Sequence |
MRHYDCKNYINLDCEKGLCALTKGMVPIDGEGSEACPNFKPAEKCGNCKNFCNPDKYGLGTCTGLEKENWAYATCGASACPSYKAE |
| Source of smORF |
Swiss-Prot |
| Function |
Component of the HPA decarboxylase that decarboxylates phenylacetates with a hydroxyl group in the p-position. Active toward 4-hydroxyphenylacetate and 3,4-dihydroxyphenylacetate, forming 4-methylphenol and 4-methylcatechol, respectively. Is likely involved in the catabolism of aromatic amino acids such as tyrosine fermentation. 4-methylphenol (p-cresol) formation provides metabolic toxicity, which allows an active suppression of other microbes and may provide growth advantages for the producers in highly competitive environments (Pubmed:16878993). The small subunit is essential for enzymatic activity of HPA decarboxylase, and seems also involved in the regulation of the enzyme oligomeric state and catalytic activity (By similarity). {ECO:0000250|UniProtKB:Q84F15, ECO:0000269|Pubmed:16878993}. |
| Pubmed ID |
16878993
21823587
|
| Domain |
CDD:408311,CDD:411304,CDD:408452 |
| Functional Category |
Metal-binding |
| Uniprot ID |
Q38HX3
|
| ORF Length (Amino Acid) |
86 |