Result : Q32GM0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Shiga toxin subunit B |
| NCBI Accession ID | CP000034.1 |
| Organism | Shigella dysenteriae serotype 1 (strain Sd197) |
| Left | 1284822 |
| Right | 1285091 |
| Strand | + |
| Nucleotide Sequence | ATGAAAAAAACATTATTAATAGCTGCATCGCTTTCATTTTTTTCAGCAAGTGCGCTGGCGACGCCTGATTGTGTAACTGGAAAGGTGGAGTATACAAAATATAATGATGACGATACCTTTACAGTTAAAGTGGGTGATAAAGAATTATTTACCAACAGATGGAATCTTCAGTCTCTTCTTCTCAGTGCGCAAATTACGGGGATGACTGTAACCATTAAAACTAATGCCTGTCATAATGGAGGGGGATTCAGCGAAGTTATTTTTCGTTGA |
| Sequence | MKKTLLIAASLSFFSASALATPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR |
| Source of smORF | Swiss-Prot |
| Function | The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli. {ECO:0000250}. |
| Pubmed ID | 16275786 |
| Domain | CDD:396713 |
| Functional Category | Others |
| Uniprot ID | Q32GM0 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2323023 | 2323292 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 2 | 2924625 | 2924894 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 1268129 | 1268347 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP061527.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00665.28 | 1.0 | 2 | 2198 | opposite-strand | Integrase core domain |
| 2 | PF13683.8 | 1.0 | 2 | 2198 | opposite-strand | Integrase core domain |
| 3 | PF00959.21 | 1.0 | 2 | 3334.5 | same-strand | Phage lysozyme |
| 4 | PF04971.14 | 1.0 | 2 | 3114.5 | same-strand | Bacteriophage P21 holin S |
| 5 | PF16080.7 | 1.0 | 2 | 3114.5 | same-strand | Bacteriophage holin family HP1 |
| 6 | PF05696.13 | 1.0 | 2 | 2792.0 | same-strand | Protein of unknown function (DUF826) |
| 7 | PF08410.12 | 1.0 | 2 | 510 | same-strand | Domain of unknown function (DUF1737) |
| 8 | PF00161.21 | 1.0 | 2 | 10 | same-strand | Ribosome inactivating protein |
| 9 | PF13333.8 | 1.0 | 2 | 1664.0 | both-strands | Integrase core domain |
| 10 | PF13276.8 | 1.0 | 2 | 1664.0 | both-strands | HTH-like domain |
| 11 | PF01527.22 | 1.0 | 2 | 2564.5 | both-strands | Transposase |
++ More..