Protein Information |
Information Type | Description |
---|---|
Protein name | Shiga toxin subunit B |
NCBI Accession ID | CP000034.1 |
Organism | Shigella dysenteriae serotype 1 (strain Sd197) |
Left | 1284822 |
Right | 1285091 |
Strand | + |
Nucleotide Sequence | ATGAAAAAAACATTATTAATAGCTGCATCGCTTTCATTTTTTTCAGCAAGTGCGCTGGCGACGCCTGATTGTGTAACTGGAAAGGTGGAGTATACAAAATATAATGATGACGATACCTTTACAGTTAAAGTGGGTGATAAAGAATTATTTACCAACAGATGGAATCTTCAGTCTCTTCTTCTCAGTGCGCAAATTACGGGGATGACTGTAACCATTAAAACTAATGCCTGTCATAATGGAGGGGGATTCAGCGAAGTTATTTTTCGTTGA |
Sequence | MKKTLLIAASLSFFSASALATPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR |
Source of smORF | Swiss-Prot |
Function | The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli. {ECO:0000250}. |
Pubmed ID | 16275786 |
Domain | CDD:396713 |
Functional Category | Others |
Uniprot ID | Q32GM0 |
ORF Length (Amino Acid) | 89 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2323023 | 2323292 | - | NZ_CP061527.1 | Shigella dysenteriae |
2 | 2924625 | 2924894 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
3 | 1268129 | 1268347 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00665.28 | 1.0 | 2 | 2198 | opposite-strand | Integrase core domain |
2 | PF13683.8 | 1.0 | 2 | 2198 | opposite-strand | Integrase core domain |
3 | PF00959.21 | 1.0 | 2 | 3334.5 | same-strand | Phage lysozyme |
4 | PF04971.14 | 1.0 | 2 | 3114.5 | same-strand | Bacteriophage P21 holin S |
5 | PF16080.7 | 1.0 | 2 | 3114.5 | same-strand | Bacteriophage holin family HP1 |
6 | PF05696.13 | 1.0 | 2 | 2792.0 | same-strand | Protein of unknown function (DUF826) |
7 | PF08410.12 | 1.0 | 2 | 510 | same-strand | Domain of unknown function (DUF1737) |
8 | PF00161.21 | 1.0 | 2 | 10 | same-strand | Ribosome inactivating protein |
9 | PF13333.8 | 1.0 | 2 | 1664.0 | both-strands | Integrase core domain |
10 | PF13276.8 | 1.0 | 2 | 1664.0 | both-strands | HTH-like domain |
11 | PF01527.22 | 1.0 | 2 | 2564.5 | both-strands | Transposase |