Result : A7NR21
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | CP000804.1 |
| Organism | Roseiflexus castenholzii (strain DSM 13941 / HLO8) |
| Left | 5196213 |
| Right | 5196509 |
| Strand | - |
| Nucleotide Sequence | ATGTTGCTGACCATGGAAGATGTGGAGCACGTCGCACGCCTGGCGCGTCTGCGCCTTTCGCCAGATGAACTGGAGCATATGCGCGATCAATTGTCGAAGATTCTTGATCATTTTCAGATGTTGCAGCAGATCGATGTCAGCGCTGTTCCACCAACTGCGCAGGTGACCGATCTGATCAATGTGATGCGCGAGGATGAGGTGCGTCCGTCACTGCCGCGCGAACAGGCGCTGGCAAACGCTCCCGAACAACAGGATGGAATGTTTCGCGTCCGTGCCATCTTTGAAGAAGCGTCATAA |
| Sequence | MLLTMEDVEHVARLARLRLSPDELEHMRDQLSKILDHFQMLQQIDVSAVPPTAQVTDLINVMREDEVRPSLPREQALANAPEQQDGMFRVRAIFEEAS |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | A7NR21 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 44
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5196213 | 5196509 | - | NC_009767.1 | Roseiflexus castenholzii DSM 13941 |
| 2 | 2633582 | 2633872 | + | NC_011831.1 | Chloroflexus aggregans DSM 9485 |
| 3 | 1762739 | 1763032 | - | NC_011959.1 | Thermomicrobium roseum DSM 5159 |
| 4 | 239907 | 240194 | + | NZ_CP042829.1 | Tepidiforma bonchosmolovskayae |
| 5 | 2132548 | 2132841 | - | NC_013523.1 | Sphaerobacter thermophilus DSM 20745 |
| 6 | 1404566 | 1404856 | - | NC_017079.1 | Caldilinea aerophila DSM 14535 = NBRC 104270 |
| 7 | 569306 | 569596 | + | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 8 | 204337 | 204624 | + | NZ_CP033433.1 | Cohnella candidum |
| 9 | 2862953 | 2863213 | - | NZ_CP024955.1 | Kyrpidia spormannii |
| 10 | 2874281 | 2874541 | - | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 11 | 3153158 | 3153448 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 12 | 1156743 | 1157045 | + | NZ_CP045851.1 | Actinomarinicola tropica |
| 13 | 5493326 | 5493565 | - | NZ_LR134338.1 | Brevibacillus brevis |
| 14 | 657806 | 658066 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 15 | 5188740 | 5189027 | - | NZ_AP019400.1 | Cohnella abietis |
| 16 | 2260877 | 2261167 | - | NZ_CP034118.1 | Staphylospora marina |
| 17 | 5168194 | 5168433 | - | NZ_CP026363.1 | Brevibacillus agri |
| 18 | 4199797 | 4200084 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 19 | 2245720 | 2246004 | - | NZ_CP046996.1 | Dehalobacter restrictus |
| 20 | 183326 | 183589 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 21 | 2978277 | 2978561 | - | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 22 | 389884 | 390126 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 23 | 2507249 | 2507530 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 24 | 308489 | 308728 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 25 | 2964575 | 2964871 | - | NZ_AP014924.1 | Limnochorda pilosa |
| 26 | 2360679 | 2360933 | + | NZ_CP043930.1 | Gimesia benthica |
| 27 | 10018351 | 10018623 | - | NZ_CP035758.1 | Ktedonosporobacter rubrisoli |
| 28 | 1617433 | 1617687 | + | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 29 | 3991314 | 3991562 | - | NZ_LT828648.1 | Nitrospira japonica |
| 30 | 1675772 | 1676059 | - | NZ_CP041217.1 | Saccharibacillus brassicae |
| 31 | 2799529 | 2799813 | - | NZ_CP045875.1 | Heliorestis convoluta |
| 32 | 1748031 | 1748288 | + | NZ_CP022203.1 | Corallococcus macrosporus DSM 14697 |
| 33 | 451272 | 451562 | + | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 34 | 576249 | 576539 | + | NZ_LT906446.1 | Megamonas hypermegale |
| 35 | 1722155 | 1722412 | + | NC_008095.1 | Myxococcus xanthus DK 1622 |
| 36 | 939560 | 939805 | + | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 37 | 1853100 | 1853387 | + | NC_020126.1 | Myxococcus stipitatus DSM 14675 |
| 38 | 2301599 | 2301892 | - | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 39 | 864987 | 865268 | + | NC_008148.1 | Rubrobacter xylanophilus DSM 9941 |
| 40 | 5652832 | 5653131 | - | NZ_CP036275.1 | Maioricimonas rarisocia |
| 41 | 3103197 | 3103493 | - | NC_013929.1 | Streptomyces scabiei 87.22 |
| 42 | 3816540 | 3816830 | - | NC_013739.1 | Conexibacter woesei DSM 14684 |
| 43 | 3281519 | 3281815 | + | NZ_CP042430.1 | Baekduia soli |
| 44 | 4331558 | 4331848 | + | NZ_CP012332.1 | Vulgatibacter incomptus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP039710.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01425.23 | 0.95 | 42 | 19 | same-strand | Amidase |
| 2 | PF02934.17 | 0.84 | 37 | 1510 | same-strand | GatB/GatE catalytic domain |
| 3 | PF02637.20 | 0.82 | 36 | 1510.0 | same-strand | GatB domain |
++ More..