Result : Q31RR1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | CP000100.1 |
| Organism | Synechococcus elongatus (strain PCC 7942 / FACHB-805) (Anacystis nidulans R2) |
| Left | 224357 |
| Right | 224632 |
| Strand | + |
| Nucleotide Sequence | ATGAACTTTTTCGGTATTGGTCTGCCTGAAATGCTGGTGATCCTAGCGATCGCCCTGTTGGTGTTTGGCCCCAAAAAGCTGCCCGAAATTGGTCGCAGTCTAGGAAAGGCGTTGCGGGGCTTCCAAGATGCATCACGGGAATTTGAGTCGGAGATCAAGCGCGAGATCGATCGCACCCCTGCCACGCCAGCAGAAGCAACGGTAGAACCCCCAGTCTTAGATTCGGCTCCTACCGAAGCGGTCACTGTCGAGAAACAAACGGAGACGCAGGTGTGA |
| Sequence | MNFFGIGLPEMLVILAIALLVFGPKKLPEIGRSLGKALRGFQDASREFESEIKREIDRTPATPAEATVEPPVLDSAPTEAVTVEKQTETQV |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | Q31RR1 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 14
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2537354 | 2537638 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 2 | 3110314 | 3110622 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 3 | 3945776 | 3946060 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 4 | 1435512 | 1435781 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 5 | 4699605 | 4699883 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 6 | 4155584 | 4155832 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 7 | 506498 | 506770 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 8 | 1118245 | 1118517 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 9 | 699729 | 699998 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 10 | 1990672 | 1990944 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
| 11 | 5406033 | 5406308 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 12 | 5548098 | 5548370 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 13 | 3939602 | 3939883 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 14 | 6081213 | 6081485 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014501.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01074.24 | 0.64 | 9 | 703 | same-strand | Glycosyl hydrolases family 38 N-terminal domain |
| 2 | PF07748.15 | 0.64 | 9 | 703 | same-strand | Glycosyl hydrolases family 38 C-terminal domain |
| 3 | PF09261.13 | 0.64 | 9 | 703 | same-strand | Alpha mannosidase middle domain |
| 4 | PF17677.3 | 0.64 | 9 | 703 | same-strand | Glycosyl hydrolases family 38 C-terminal beta sandwich domain |
| 5 | PF02468.17 | 0.79 | 11 | 441 | opposite-strand | Photosystem II reaction centre N protein (psbN) |
| 6 | PF00737.22 | 0.79 | 11 | 151 | same-strand | Photosystem II 10 kDa phosphoprotein |
++ More..