Protein Information |
Information Type | Description |
---|---|
Protein name | Sec-independent protein translocase protein TatA |
NCBI Accession ID | CP000100.1 |
Organism | Synechococcus elongatus (strain PCC 7942 / FACHB-805) (Anacystis nidulans R2) |
Left | 224357 |
Right | 224632 |
Strand | + |
Nucleotide Sequence | ATGAACTTTTTCGGTATTGGTCTGCCTGAAATGCTGGTGATCCTAGCGATCGCCCTGTTGGTGTTTGGCCCCAAAAAGCTGCCCGAAATTGGTCGCAGTCTAGGAAAGGCGTTGCGGGGCTTCCAAGATGCATCACGGGAATTTGAGTCGGAGATCAAGCGCGAGATCGATCGCACCCCTGCCACGCCAGCAGAAGCAACGGTAGAACCCCCAGTCTTAGATTCGGCTCCTACCGAAGCGGTCACTGTCGAGAAACAAACGGAGACGCAGGTGTGA |
Sequence | MNFFGIGLPEMLVILAIALLVFGPKKLPEIGRSLGKALRGFQDASREFESEIKREIDRTPATPAEATVEPPVLDSAPTEAVTVEKQTETQV |
Source of smORF | Swiss-Prot |
Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
Pubmed ID | |
Domain | CDD:294511 |
Functional Category | Others |
Uniprot ID | Q31RR1 |
ORF Length (Amino Acid) | 91 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2537354 | 2537638 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
2 | 3110314 | 3110622 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
3 | 3945776 | 3946060 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
4 | 1435512 | 1435781 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
5 | 4699605 | 4699883 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
6 | 4155584 | 4155832 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
7 | 506498 | 506770 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
8 | 1118245 | 1118517 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
9 | 699729 | 699998 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
10 | 1990672 | 1990944 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
11 | 5406033 | 5406308 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
12 | 5548098 | 5548370 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
13 | 3939602 | 3939883 | + | NZ_CP031941.1 | Nostoc sphaeroides |
14 | 6081213 | 6081485 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01074.24 | 0.64 | 9 | 703 | same-strand | Glycosyl hydrolases family 38 N-terminal domain |
2 | PF07748.15 | 0.64 | 9 | 703 | same-strand | Glycosyl hydrolases family 38 C-terminal domain |
3 | PF09261.13 | 0.64 | 9 | 703 | same-strand | Alpha mannosidase middle domain |
4 | PF17677.3 | 0.64 | 9 | 703 | same-strand | Glycosyl hydrolases family 38 C-terminal beta sandwich domain |
5 | PF02468.17 | 0.79 | 11 | 441 | opposite-strand | Photosystem II reaction centre N protein (psbN) |
6 | PF00737.22 | 0.79 | 11 | 151 | same-strand | Photosystem II 10 kDa phosphoprotein |