Result : Q31J39
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | YcgL domain-containing protein Tcr_0238 |
| NCBI Accession ID | CP000109.2 |
| Organism | Hydrogenovibrio crunogenus (strain XCL-2) (Thiomicrospira crunogena) |
| Left | 283180 |
| Right | 283473 |
| Strand | - |
| Nucleotide Sequence | ATGGCTTTATTGGTTTCAGCCTATAAAAGTGCAAAAAAAGACGAACTCTATTTATTTGTGCCTAAAGAAGATGGTTTGGAAAAATTATCCGATGAACTGTTAGTCATGTTCGGAGAACCACAACATGTCATTGATTTTGATCTGACAGAAAAACGTAAGCTGGCACGAGTGGACGCCGAAGAAGTAAAGAAAGCCCTCGAAACCAAAGGCTACTTCATGCAAATGCCGCCTTCGGAAATTGAAAAAATGGGTGACATGCCGCCGCCGCCGGAACATCTTGACAACATTTTTTAA |
| Sequence | MALLVSAYKSAKKDELYLFVPKEDGLEKLSDELLVMFGEPQHVIDFDLTEKRKLARVDAEEVKKALETKGYFMQMPPSEIEKMGDMPPPPEHLDNIF |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl22628. Profile Description: YcgL domain. This family of proteins formerly called DUF709 includes the E. coli gene ycgL. homologs of YcgL are found in gammaproteobacteria. The structure of this protein shows a novel alpha/beta/alpha sandwich structure. |
| Pubmed ID | 17105352 |
| Domain | CDD:419850 |
| Functional Category | Others |
| Uniprot ID | Q31J39 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 393185 | 393478 | - | NZ_CP035033.1 | Hydrogenovibrio thermophilus |
| 2 | 513591 | 513887 | - | NZ_AP021888.1 | Thiosulfativibrio zosterae |
| 3 | 2362970 | 2363266 | + | NZ_CP054020.1 | Thiomicrorhabdus xiamenensis |
| 4 | 310662 | 310898 | - | NZ_AP018722.1 | Thiomicrorhabdus aquaedulcis |
| 5 | 292140 | 292436 | - | NZ_CP040602.1 | Thiomicrorhabdus sediminis |
| 6 | 324210 | 324503 | - | NZ_AP020335.1 | Hydrogenovibrio marinus |
| 7 | 315815 | 316051 | - | NZ_AP021889.1 | Thiosulfatimonas sediminis |
| 8 | 322338 | 322634 | - | NZ_CP033040.1 | Thiomicrorhabdus indica |
| 9 | 85125 | 85364 | - | NC_015581.1 | Thiomicrospira cyclica ALM1 |
| 10 | 118713 | 119000 | - | NZ_CP007030.1 | Thiomicrospira aerophila AL3 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP035033.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00578.23 | 0.7 | 7 | 2374 | same-strand | AhpC/TSA family |
| 2 | PF13098.8 | 0.6 | 6 | 2104.0 | same-strand | Thioredoxin-like domain |
| 3 | PF02777.20 | 1.0 | 10 | 128.5 | same-strand | Iron/manganese superoxide dismutases, C-terminal domain |
| 4 | PF00081.24 | 1.0 | 10 | 128.5 | same-strand | Iron/manganese superoxide dismutases, alpha-hairpin domain |
| 5 | PF01743.22 | 1.0 | 10 | 1225.5 | opposite-strand | Poly A polymerase head domain |
| 6 | PF12627.9 | 1.0 | 10 | 1225.5 | opposite-strand | Probable RNA and SrmB- binding site of polymerase A |
++ More..