Protein Information |
Information Type | Description |
---|---|
Protein name | Carboxysome shell vertex protein CsoS4A |
NCBI Accession ID | CP000109.2 |
Organism | Hydrogenovibrio crunogenus (strain XCL-2) (Thiomicrospira crunogena) |
Left | 922410 |
Right | 922682 |
Strand | + |
Nucleotide Sequence | TTGAAAATATATAAAGTTGATAAAACCCTCGTTTCAACAAATCGTATTGCGATGATGGAGCATAAGCCTCTATTAGTTGTGCGAGAGAAAGACGGAGGCACGCCTCAAGTAGCGGTAGATCCGGTAGGTTGTAAACCAGGTGATTGGGTCATTTGTTGTGGTAGTTCGGCGGCACGTGATGCAACCGGCGTTAAAGGTTACCCTAGCGATCTCACAATAGTGGGCATTATCGATAAATGGGAAGTACCACAAGATGCAGATACTACAAGTTAA |
Sequence | MKIYKVDKTLVSTNRIAMMEHKPLLVVREKDGGTPQVAVDPVGCKPGDWVICCGSSAARDATGVKGYPSDLTIVGIIDKWEVPQDADTTS |
Source of smORF | Swiss-Prot |
Function | Probably forms vertices in the carboxysome, a polyhedral inclusion where RuBisCO (ribulose bisphosphate carboxylase, cbbL-cbbS) is sequestered. Has been modeled to induce curvature upon insertion into an otherwise flat hexagonal layer of major carboxysome subunits. {ECO:0000250|UniProtKB:O85043}. |
Pubmed ID | 17105352 28115547 |
Domain | CDD:413110 |
Functional Category | Others |
Uniprot ID | Q31HD5 |
ORF Length (Amino Acid) | 90 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1938990 | 1939262 | - | NZ_CP035033.1 | Hydrogenovibrio thermophilus |
2 | 2302599 | 2302871 | - | NZ_CP054020.1 | Thiomicrorhabdus xiamenensis |
3 | 229334 | 229606 | + | NZ_AP020335.1 | Hydrogenovibrio marinus |
4 | 2068083 | 2068355 | - | NZ_AP021888.1 | Thiosulfativibrio zosterae |
5 | 316267 | 316539 | + | NZ_CP040602.1 | Thiomicrorhabdus sediminis |
6 | 1999404 | 1999652 | - | NZ_CP007030.1 | Thiomicrospira aerophila AL3 |
7 | 1801776 | 1802024 | - | NC_015581.1 | Thiomicrospira cyclica ALM1 |
8 | 2655795 | 2656052 | - | NZ_AP021889.1 | Thiosulfatimonas sediminis |
9 | 339370 | 339627 | + | NZ_AP021889.1 | Thiosulfatimonas sediminis |
10 | 354254 | 354508 | + | NZ_CP033040.1 | Thiomicrorhabdus indica |
11 | 840572 | 840823 | - | NZ_CP046415.1 | Guyparkeria halophila |
12 | 1491164 | 1491415 | - | NZ_CP026328.2 | Acidithiobacillus caldus |
13 | 2156774 | 2157025 | - | NZ_AP018721.1 | Sulfuritortus calidifontis |
14 | 2475455 | 2475706 | - | NZ_CP045571.1 | Acidithiobacillus thiooxidans ATCC 19377 |
15 | 315124 | 315372 | + | NZ_CP017415.1 | Acidihalobacter yilgarnenesis |
16 | 234002 | 234253 | + | NZ_CP072793.1 | Thiothrix unzii |
17 | 1979271 | 1979525 | + | NZ_CP020046.1 | Thiomonas intermedia |
18 | 2499680 | 2499940 | - | NZ_AP014568.1 | Serpentinomonas raichei |
19 | 3165223 | 3165474 | - | NZ_AP021881.1 | Sulfuriferula nivalis |
20 | 828546 | 828803 | + | NC_008344.1 | Nitrosomonas eutropha C91 |
21 | 3297716 | 3297967 | - | NZ_AP021884.1 | Sulfuriferula plumbiphila |
22 | 2531820 | 2532080 | - | NZ_AP014569.1 | Serpentinomonas mccroryi |
23 | 2168242 | 2168499 | - | NC_007406.1 | Nitrobacter winogradskyi Nb-255 |
24 | 3347508 | 3347765 | - | NC_011901.1 | Thioalkalivibrio sulfidiphilus HL-EbGr7 |
25 | 2039447 | 2039698 | - | NZ_CP011367.1 | Thioalkalivibrio versutus |
26 | 3066177 | 3066425 | - | NC_015942.1 | Acidithiobacillus ferrivorans SS3 |
27 | 2390152 | 2390400 | - | NZ_AP018795.1 | Acidithiobacillus ferridurans |
28 | 1457962 | 1458210 | - | NC_011761.1 | Acidithiobacillus ferrooxidans ATCC 23270 |
29 | 3241054 | 3241308 | + | NC_019940.1 | Thioflavicoccus mobilis 8321 |
30 | 3075866 | 3076129 | - | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
31 | 2652472 | 2652735 | - | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
32 | 135209 | 135460 | + | NC_013124.1 | Acidimicrobium ferrooxidans DSM 10331 |
33 | 3481928 | 3482173 | - | NZ_CP007031.1 | Marichromatium purpuratum 984 |
34 | 519231 | 519485 | + | NZ_AP018725.1 | Sulfuriflexus mobilis |
35 | 3106115 | 3106360 | - | NC_013851.1 | Allochromatium vinosum DSM 180 |
36 | 530334 | 530609 | + | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
37 | 283399 | 283656 | + | NC_007959.1 | Nitrobacter hamburgensis X14 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00210.26 | 0.81 | 29 | 1339.5 | same-strand | Ferritin-like domain |
2 | PF00936.21 | 1.0 | 36 | 647 | same-strand | BMC domain |
3 | PF03319.15 | 0.97 | 35 | 0.0 | same-strand | Ethanolamine utilisation protein EutN/carboxysome |
4 | PF08936.12 | 0.94 | 34 | 11 | same-strand | Carboxysome Shell Carbonic Anhydrase |
5 | PF12288.10 | 0.78 | 28 | 1574 | same-strand | Carboxysome shell peptide mid-region |
6 | PF00101.22 | 0.97 | 35 | 4020.0 | same-strand | Ribulose bisphosphate carboxylase, small chain |
7 | PF00016.22 | 0.97 | 35 | 4392.0 | same-strand | Ribulose bisphosphate carboxylase large chain, catalytic domain |
8 | PF02788.18 | 0.97 | 35 | 4392.0 | same-strand | Ribulose bisphosphate carboxylase large chain, N-terminal domain |