Protein Information |
Information Type | Description |
---|---|
Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
NCBI Accession ID | CP000109.2 |
Organism | Hydrogenovibrio crunogenus (strain XCL-2) (Thiomicrospira crunogena) |
Left | 1782356 |
Right | 1782643 |
Strand | - |
Nucleotide Sequence | GTGTCTTTAGAAAAAACTGAAGTCGATACGATTTCACGTCTTGCTGCTATTTCGGTTGATGCCTCAGAAGTCGATCAATTGACGGCTAAAATTTCTAATGTTCTTGATCTTTTTCAACGAATGGAAGCGGTGGATACAACAAATGTAGAGCCGATGTCTCATCCCTTGGATCAAGTTCAGAGATTAAGAGAAGATGTGGTGACCGAAACCGATCATCACGAAGAGTATCAAAAGTTAGCACCTGCAGCTGAAAAAGGCATGTATTTGGTGCCGCAAGTAATTGATTAA |
Sequence | MSLEKTEVDTISRLAAISVDASEVDQLTAKISNVLDLFQRMEAVDTTNVEPMSHPLDQVQRLREDVVTETDHHEEYQKLAPAAEKGMYLVPQVID |
Source of smORF | Swiss-Prot |
Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
Pubmed ID | 17105352 |
Domain | CDD:412411 |
Functional Category | Others |
Uniprot ID | Q31F52 |
ORF Length (Amino Acid) | 95 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1864717 | 1865004 | - | NZ_CP035033.1 | Hydrogenovibrio thermophilus |
2 | 919597 | 919884 | + | NZ_AP021888.1 | Thiosulfativibrio zosterae |
3 | 1969431 | 1969718 | - | NZ_AP020335.1 | Hydrogenovibrio marinus |
4 | 679789 | 680076 | + | NZ_AP018722.1 | Thiomicrorhabdus aquaedulcis |
5 | 678350 | 678637 | + | NZ_CP040602.1 | Thiomicrorhabdus sediminis |
6 | 2143583 | 2143870 | - | NZ_CP033040.1 | Thiomicrorhabdus indica |
7 | 1928451 | 1928738 | - | NZ_CP054020.1 | Thiomicrorhabdus xiamenensis |
8 | 844028 | 844315 | + | NZ_AP021889.1 | Thiosulfatimonas sediminis |
9 | 2977456 | 2977743 | + | NZ_CP014646.1 | Thauera humireducens |
10 | 3159660 | 3159947 | + | NZ_CP029822.1 | Entomomonas moraniae |
11 | 3918748 | 3919035 | + | NZ_LR215729.2 | Pseudomonas marincola |
12 | 297777 | 298064 | + | NZ_AP012273.1 | Thiolapillus brandeum |
13 | 1430964 | 1431251 | - | NC_015581.1 | Thiomicrospira cyclica ALM1 |
14 | 4007689 | 4007976 | - | NZ_CP022684.1 | Ketobacter alkanivorans |
15 | 3118056 | 3118343 | + | NZ_CP011412.1 | Sedimenticola thiotaurini |
16 | 505072 | 505359 | + | NZ_CP007030.1 | Thiomicrospira aerophila AL3 |
17 | 2665119 | 2665406 | - | NC_012969.1 | Methylovorus glucosetrophus SIP3-4 |
18 | 3472919 | 3473206 | + | NZ_CP072793.1 | Thiothrix unzii |
19 | 1655877 | 1656164 | - | NZ_CP061941.1 | Marinomonas algicola |
20 | 3813272 | 3813556 | - | NZ_CP053073.1 | Usitatibacter palustris |
21 | 1956219 | 1956506 | - | NC_015276.1 | Marinomonas mediterranea MMB-1 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02934.17 | 1.0 | 21 | 1486 | same-strand | GatB/GatE catalytic domain |
2 | PF02637.20 | 1.0 | 21 | 1486 | same-strand | GatB domain |
3 | PF01425.23 | 1.0 | 21 | 16 | same-strand | Amidase |
4 | PF06723.15 | 0.9 | 19 | 248 | opposite-strand | MreB/Mbl protein |
5 | PF14450.8 | 0.76 | 16 | 262.0 | opposite-strand | Cell division protein FtsA |
6 | PF04085.16 | 0.9 | 19 | 1432 | opposite-strand | rod shape-determining protein MreC |
7 | PF04093.14 | 0.9 | 19 | 2318 | opposite-strand | rod shape-determining protein MreD |
8 | PF00905.24 | 0.67 | 14 | 2814.5 | opposite-strand | Penicillin binding protein transpeptidase domain |
9 | PF03717.17 | 0.67 | 14 | 2814.5 | opposite-strand | Penicillin-binding Protein dimerisation domain |
10 | PF01098.21 | 0.67 | 14 | 4655.0 | opposite-strand | Cell cycle protein |