Result : Q31E61
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | CP000109.2 |
| Organism | Hydrogenovibrio crunogenus (strain XCL-2) (Thiomicrospira crunogena) |
| Left | 2167809 |
| Right | 2168069 |
| Strand | + |
| Nucleotide Sequence | ATGGGCATTAGCATTTGGCAATTATTAATCATCCTTGCAATCGTTTTGGTACTGTTTGGAGCCAAAAGACTGAAAAACGTTGGGTCTGATCTAGGTGGTGCAATCAAAGGCTTCAAGAAAGCGGTTTCAGACGAAGATAAAAAAGAAGACGAAAAAGTCACTGCCGAGCAAAAACTGGAACAGAAAGAAGGTGAAAACGTTTTTGATGTGAAAGCTGAGCAAAAAGCAGACGAAAAATCAGAAACAAAAGATAAAGCATAA |
| Sequence | MGISIWQLLIILAIVLVLFGAKRLKNVGSDLGGAIKGFKKAVSDEDKKEDEKVTAEQKLEQKEGENVFDVKAEQKADEKSETKDKA |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | 17105352 |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | Q31E61 |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 93
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 284486 | 284743 | - | NZ_AP021888.1 | Thiosulfativibrio zosterae |
| 2 | 2259152 | 2259397 | + | NZ_AP020335.1 | Hydrogenovibrio marinus |
| 3 | 2322765 | 2323022 | + | NZ_CP035033.1 | Hydrogenovibrio thermophilus |
| 4 | 197949 | 198200 | - | NZ_CP040602.1 | Thiomicrorhabdus sediminis |
| 5 | 2679173 | 2679427 | + | NZ_CP033040.1 | Thiomicrorhabdus indica |
| 6 | 217304 | 217555 | - | NZ_CP054020.1 | Thiomicrorhabdus xiamenensis |
| 7 | 1985813 | 1986070 | + | NZ_CP007030.1 | Thiomicrospira aerophila AL3 |
| 8 | 1788193 | 1788450 | + | NC_015581.1 | Thiomicrospira cyclica ALM1 |
| 9 | 214720 | 214974 | - | NZ_AP021889.1 | Thiosulfatimonas sediminis |
| 10 | 3350288 | 3350527 | + | NC_017506.1 | Marinobacter adhaerens HP15 |
| 11 | 3993296 | 3993535 | + | NZ_CP043042.1 | Marinobacter fonticola |
| 12 | 660676 | 660948 | - | NC_007963.1 | Chromohalobacter salexigens DSM 3043 |
| 13 | 4263052 | 4263279 | - | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 14 | 3442729 | 3442959 | - | NZ_CP029185.2 | Limnobaculum parvum |
| 15 | 3847092 | 3847337 | - | NZ_CP017715.1 | Marinobacter salinus |
| 16 | 422671 | 422880 | + | NZ_CP031769.1 | Salinimonas sediminis |
| 17 | 81805 | 82020 | + | NZ_CP011797.1 | Reinekea forsetii |
| 18 | 2993865 | 2994074 | + | NZ_CP029347.1 | Saliniradius amylolyticus |
| 19 | 1902969 | 1903196 | - | NZ_CP016604.1 | Otariodibacter oris |
| 20 | 1052637 | 1052879 | - | NZ_CP007142.1 | Gynuella sunshinyii YC6258 |
| 21 | 93813 | 94067 | + | NC_011753.2 | Vibrio atlanticus |
| 22 | 2330073 | 2330294 | - | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
| 23 | 1373845 | 1374099 | - | NZ_CP065150.1 | Vibrio kanaloae |
| 24 | 3234941 | 3235195 | - | NZ_CP039700.1 | Vibrio cyclitrophicus |
| 25 | 602977 | 603222 | - | NZ_CP046378.1 | Shewanella algae |
| 26 | 3759715 | 3759960 | - | NZ_AP014545.1 | Amphritea japonica ATCC BAA-1530 |
| 27 | 101981 | 102229 | - | NZ_CP011025.1 | Pseudoalteromonas arctica A 37-1-2 |
| 28 | 1893633 | 1893851 | - | NZ_CP019343.1 | Oceanicoccus sagamiensis |
| 29 | 3110056 | 3110286 | - | NZ_CP019240.1 | Rhodoferax antarcticus |
| 30 | 2182979 | 2183239 | - | NZ_CP018139.1 | Halomonas aestuarii |
| 31 | 4164519 | 4164749 | + | NZ_CP016176.1 | Xenorhabdus hominickii |
| 32 | 3840627 | 3840863 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 33 | 3120151 | 3120387 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 34 | 310930 | 311166 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 35 | 1402506 | 1402718 | - | NZ_CP042382.1 | Pistricoccus aurantiacus |
| 36 | 4489239 | 4489463 | - | NZ_LR134376.1 | Aeromonas encheleia |
| 37 | 406493 | 406735 | - | NZ_CP040990.1 | Vibrio furnissii |
| 38 | 96580 | 96789 | + | NZ_CP031415.1 | Saccharospirillum mangrovi |
| 39 | 873780 | 874034 | - | NC_010995.1 | Cellvibrio japonicus Ueda107 |
| 40 | 3386114 | 3386368 | + | NZ_CP021435.1 | Halomonas beimenensis |
| 41 | 2805910 | 2806152 | + | NZ_CP014035.2 | Vibrio fluvialis |
| 42 | 699475 | 699699 | + | NZ_CP015029.1 | Frederiksenia canicola |
| 43 | 3142931 | 3143185 | + | NZ_CP051180.1 | Ferrimonas lipolytica |
| 44 | 3144159 | 3144425 | + | NZ_CP014226.1 | Halomonas chromatireducens |
| 45 | 4120132 | 4120347 | + | NZ_CP060401.1 | Xenorhabdus nematophila |
| 46 | 1911328 | 1911567 | + | NZ_CP046793.1 | Vibrio metschnikovii |
| 47 | 4408571 | 4408810 | + | NZ_CP020472.1 | Shewanella japonica |
| 48 | 3526096 | 3526320 | + | NZ_CP065745.1 | Aeromonas allosaccharophila |
| 49 | 3274956 | 3275180 | + | NZ_CP044060.1 | Aeromonas veronii |
| 50 | 2210449 | 2210691 | - | NZ_CP059082.1 | Halomonas titanicae |
| 51 | 2260095 | 2260325 | + | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
| 52 | 319901 | 320137 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 53 | 2988320 | 2988583 | - | NZ_FO704551.1 | Xenorhabdus poinarii G6 |
| 54 | 469716 | 469955 | - | NC_011566.1 | Shewanella piezotolerans WP3 |
| 55 | 3324631 | 3324888 | + | NZ_AP022843.1 | Halomonas hydrothermalis |
| 56 | 587266 | 587535 | - | NZ_CP065435.1 | Halomonas sp. SS10-MC5 |
| 57 | 3685332 | 3685589 | - | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 58 | 3226482 | 3226724 | - | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
| 59 | 217653 | 217874 | + | NZ_LS483470.1 | Leminorella richardii |
| 60 | 810541 | 810777 | - | NZ_CP020931.1 | Marinobacter salarius |
| 61 | 973120 | 973353 | - | NZ_CP014544.1 | Zhongshania aliphaticivorans |
| 62 | 1648186 | 1648410 | - | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
| 63 | 1646165 | 1646389 | - | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
| 64 | 3351229 | 3351477 | - | NZ_AP014635.1 | Vibrio tritonius |
| 65 | 291719 | 291940 | + | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 66 | 3567689 | 3567946 | + | NZ_CP065135.1 | Halomonas venusta |
| 67 | 3261675 | 3261899 | + | NC_014532.2 | Halomonas elongata DSM 2581 |
| 68 | 2859333 | 2859542 | - | NZ_AP014524.1 | Vibrio cholerae MS6 |
| 69 | 2432734 | 2432949 | - | NZ_CP023559.1 | Salinicola tamaricis |
| 70 | 2517301 | 2517549 | - | NZ_CP035688.1 | Vibrio metoecus |
| 71 | 1725914 | 1726147 | + | NZ_CP022684.1 | Ketobacter alkanivorans |
| 72 | 927149 | 927364 | - | NZ_CP014671.1 | Immundisolibacter cernigliae |
| 73 | 3134529 | 3134774 | + | NZ_CP048602.1 | Halomonas piezotolerans |
| 74 | 876160 | 876378 | - | NZ_CP014143.1 | Microbulbifer aggregans |
| 75 | 3322074 | 3322289 | + | NZ_CP011412.1 | Sedimenticola thiotaurini |
| 76 | 1077162 | 1077404 | - | NC_007645.1 | Hahella chejuensis KCTC 2396 |
| 77 | 3492320 | 3492538 | + | NZ_CP054301.1 | Marinomonas primoryensis |
| 78 | 77864 | 78073 | + | NC_021291.1 | Spiribacter salinus M19-40 |
| 79 | 427384 | 427599 | + | NZ_CP046670.1 | Alteromonas mediterranea |
| 80 | 641019 | 641288 | - | NZ_CP013106.1 | Halomonas huangheensis |
| 81 | 237032 | 237244 | + | NC_011901.1 | Thioalkalivibrio sulfidiphilus HL-EbGr7 |
| 82 | 497975 | 498193 | - | NC_015559.1 | Marinomonas posidonica IVIA-Po-181 |
| 83 | 1502589 | 1502813 | + | NZ_CP070273.1 | Marinomonas foliarum |
| 84 | 3212325 | 3212561 | + | NZ_CP051183.1 | Bermanella marisrubri |
| 85 | 3173928 | 3174167 | - | NC_018868.3 | Simiduia agarivorans SA1 = DSM 21679 |
| 86 | 2570948 | 2571157 | + | NC_008260.1 | Alcanivorax borkumensis SK2 |
| 87 | 574142 | 574357 | + | NZ_CP008849.1 | Alteromonas australica |
| 88 | 360678 | 360917 | + | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 89 | 1375223 | 1375447 | - | NC_011852.1 | Glaesserella parasuis SH0165 |
| 90 | 514264 | 514479 | - | NZ_CP013189.1 | Pseudohongiella spirulinae |
| 91 | 134188 | 134424 | - | NZ_CP017689.1 | Thalassotalea crassostreae |
| 92 | 383437 | 383661 | + | NZ_CP005974.1 | Photobacterium gaetbulicola Gung47 |
| 93 | 441856 | 442077 | + | NZ_AP022853.1 | Sulfurimicrobium lacus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017506.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00902.20 | 1.0 | 93 | 496 | same-strand | Sec-independent protein translocase protein (TatC) |
| 2 | PF01209.20 | 0.71 | 66 | 2497.0 | same-strand | ubiE/COQ5 methyltransferase family |
| 3 | PF13649.8 | 0.71 | 66 | 2497.0 | same-strand | Methyltransferase domain |
| 4 | PF08241.14 | 0.71 | 66 | 2497.0 | same-strand | Methyltransferase domain |
| 5 | PF13489.8 | 0.71 | 66 | 2497.0 | same-strand | Methyltransferase domain |
| 6 | PF08242.14 | 0.71 | 66 | 2497.0 | same-strand | Methyltransferase domain |
| 7 | PF02036.19 | 0.7 | 65 | 1807 | same-strand | SCP-2 sterol transfer family |
| 8 | PF03109.18 | 0.76 | 71 | 288.5 | same-strand | ABC1 atypical kinase-like domain |
++ More..