Result : Q31CT1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Photosystem II reaction center protein H (PSII-H) |
| NCBI Accession ID | CP000111.1 |
| Organism | Prochlorococcus marinus (strain MIT 9312) |
| Left | 242479 |
| Right | 242679 |
| Strand | - |
| Nucleotide Sequence | ATGGGTCAAAAAACAGCATTAGGAAGTCTTTTAAAAGCTATTGGCAATTCAGGTCAAGGAAAAGTTGTACCTGGTTGGGGAGCAGTTCCTGTTATGACAGTCATAGGATTACTACTTCTGGTTTTTTTAGTTATTCTTCTACAAATTTATAATCAATCTCTACTTTTACAAGGTTTCTCAGTAGATTGGAACGGAAACTAA |
| Sequence | MGQKTALGSLLKAIGNSGQGKVVPGWGAVPVMTVIGLLLLVFLVILLQIYNQSLLLQGFSVDWNGN |
| Source of smORF | Swiss-Prot |
| Function | One of the components of the core complex of photosystem II (PSII), required for its stability and/or assembly. PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. {ECO:0000255|HAMAP-Rule:MF_00752}. |
| Pubmed ID | |
| Domain | CDD:420012 |
| Functional Category | Others |
| Uniprot ID | Q31CT1 |
| ORF Length (Amino Acid) | 66 |
++ More..
| Conservation Analysis |
No. of Species: 25
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 275064 | 275267 | - | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 2 | 1113308 | 1113511 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 3 | 2183350 | 2183550 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 4 | 1436053 | 1436256 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 5 | 1683478 | 1683681 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 6 | 5405679 | 5405882 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 7 | 2742838 | 2743041 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 8 | 1182564 | 1182767 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 9 | 1991099 | 1991302 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
| 10 | 2616298 | 2616501 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 11 | 915367 | 915561 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 12 | 1118643 | 1118846 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 13 | 1991231 | 1991431 | - | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 14 | 6050609 | 6050812 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 15 | 699395 | 699595 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 16 | 5547745 | 5547948 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 17 | 367231 | 367434 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 18 | 6081637 | 6081840 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 19 | 3945470 | 3945673 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 20 | 3939248 | 3939451 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 21 | 4963324 | 4963518 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 22 | 4699237 | 4699440 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 23 | 507197 | 507385 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 24 | 5750199 | 5750408 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 25 | 1004740 | 1004940 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_005042.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01195.21 | 0.64 | 16 | 459.0 | same-strand | Peptidyl-tRNA hydrolase |
| 2 | PF02416.18 | 0.92 | 23 | 151 | same-strand | mttA/Hcf106 family |
| 3 | PF02468.17 | 0.84 | 21 | 86 | opposite-strand | Photosystem II reaction centre N protein (psbN) |
++ More..