Result : Q312I9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein SlyX homolog |
| NCBI Accession ID | CP000112.1 |
| Organism | Desulfovibrio alaskensis (strain G20) (Desulfovibrio desulfuricans (strain G20)) |
| Left | 1371708 |
| Right | 1371929 |
| Strand | - |
| Nucleotide Sequence | ATGACAAAAACGCTTGAAGACCGCATTATCAAGCTGGAAGAAACGGTATATTTTCAGGAAAAAACCATAAGCGAACTGAATGATGCGCTGACGCAGCAGCAGTTGCAGCTGGACGAAATGCACAAGCTGCAGCAGGCCGTGGAAATCAAACTGCGCCAGATGGCCCCGCTGCTGCGCGATGCGGACGCAGGCGATGACGGCCCGCCCCCCCACTATCTGTAA |
| Sequence | MTKTLEDRIIKLEETVYFQEKTISELNDALTQQQLQLDEMHKLQQAVEIKLRQMAPLLRDADAGDDGPPPHYL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01090. Profile Description: SlyX. hypothetical protein; Provisional |
| Pubmed ID | 21685289 |
| Domain | CDD:412736 |
| Functional Category | Others |
| Uniprot ID | Q312I9 |
| ORF Length (Amino Acid) | 73 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1371708 | 1371929 | - | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 2 | 2528701 | 2528922 | + | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007519.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13426.9 | 1.0 | 2 | 4679 | opposite-strand | PAS domain |
| 2 | PF01878.20 | 1.0 | 2 | -3.0 | same-strand | EVE domain |
| 3 | PF02457.18 | 1.0 | 2 | 653.0 | same-strand | DisA bacterial checkpoint controller nucleotide-binding |
| 4 | PF08497.12 | 1.0 | 2 | 3550.5 | same-strand | Radical SAM N-terminal |
| 5 | PF04055.23 | 1.0 | 2 | 3550.5 | same-strand | Radical SAM superfamily |
| 6 | PF02518.28 | 1.0 | 2 | 5729.5 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 7 | PF00512.27 | 1.0 | 2 | 5729.5 | opposite-strand | His Kinase A (phospho-acceptor) domain |
| 8 | PF01590.28 | 1.0 | 2 | 5729.5 | opposite-strand | GAF domain |
| 9 | PF08448.12 | 1.0 | 2 | 5729.5 | opposite-strand | PAS fold |
| 10 | PF13185.8 | 1.0 | 2 | 5729.5 | opposite-strand | GAF domain |
| 11 | PF00989.27 | 1.0 | 2 | 5729.5 | opposite-strand | PAS fold |
++ More..