Protein Information |
Information Type | Description |
---|---|
Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
NCBI Accession ID | CP000112.1 |
Organism | Desulfovibrio alaskensis (strain G20) (Desulfovibrio desulfuricans (strain G20)) |
Left | 2243208 |
Right | 2243450 |
Strand | - |
Nucleotide Sequence | ATGACCGGAACCGGAACGACGGGTTTTGAAGAACAGCTGGCGCGCCTGCAGGAGATAGTCCGCAGGCTGGAGACCGGCGAACTGCCTCTGGAAGAGGGCGTGGCGCTGTACAAGGAAGGTCTGGAACTGGCTGCGGGGTGCCGCAAACGGTTGCAAACGGCGCGCAATGATATCAAAGTATTCAGCGACGGCGTATTGAAGGACTTTGACATGCCGGAAGATTCTCCGGCGGCGGATGACTGA |
Sequence | MTGTGTTGFEEQLARLQEIVRRLETGELPLEEGVALYKEGLELAAGCRKRLQTARNDIKVFSDGVLKDFDMPEDSPAADD |
Source of smORF | Swiss-Prot |
Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
Pubmed ID | 21685289 |
Domain | CDD:412547 |
Functional Category | Others |
Uniprot ID | Q30Z97 |
ORF Length (Amino Acid) | 80 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2243208 | 2243450 | - | NC_007519.1 | Desulfovibrio alaskensis G20 |
2 | 597033 | 597227 | + | NZ_AP017378.1 | Desulfovibrio ferrophilus |
3 | 1023780 | 1023989 | + | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
4 | 351308 | 351544 | + | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
5 | 3271592 | 3271792 | + | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
6 | 2872306 | 2872542 | - | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
7 | 2026205 | 2026477 | - | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
8 | 3353709 | 3353903 | + | NC_016803.1 | Pseudodesulfovibrio mercurii |
9 | 818189 | 818389 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
10 | 2721169 | 2721426 | - | NC_012796.1 | Desulfovibrio magneticus RS-1 |
11 | 2128026 | 2128283 | + | NZ_CP026538.1 | Desulfovibrio carbinolicus |
12 | 1183734 | 1183946 | + | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13292.8 | 1.0 | 12 | 937.0 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
2 | PF02779.26 | 1.0 | 12 | 937.0 | same-strand | Transketolase, pyrimidine binding domain |
3 | PF02780.22 | 1.0 | 12 | 937.0 | same-strand | Transketolase, C-terminal domain |
4 | PF00348.19 | 1.0 | 12 | -10.0 | same-strand | Polyprenyl synthetase |
5 | PF01551.24 | 0.67 | 8 | 87 | same-strand | Peptidase family M23 |
6 | PF02601.17 | 1.0 | 12 | 989.0 | same-strand | Exonuclease VII, large subunit |
7 | PF13742.8 | 1.0 | 12 | 989.0 | same-strand | OB-fold nucleic acid binding domain |
8 | PF01336.27 | 0.75 | 9 | 958 | same-strand | OB-fold nucleic acid binding domain |
9 | PF00587.27 | 0.75 | 9 | 2498 | same-strand | tRNA synthetase class II core domain (G, H, P, S and T) |
10 | PF04073.17 | 0.75 | 9 | 2498 | same-strand | Aminoacyl-tRNA editing domain |
11 | PF03129.22 | 0.75 | 9 | 2498 | same-strand | Anticodon binding domain |
12 | PF04551.16 | 0.67 | 8 | 4169.5 | same-strand | GcpE protein |