Result : Q30R53
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | CP000153.1 |
| Organism | Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) (Thiomicrospira denitrificans (strain ATCC 33889 / DSM 1251)) |
| Left | 1318513 |
| Right | 1318803 |
| Strand | + |
| Nucleotide Sequence | ATGCAAGTAGATGATGTATTATTAAGTAGATTAGAAAAGCTATCTTTTTTAAAAATATCTGAAGACAAAAGAGAGGAGATAGTATCTCAACTCTCTGAAATTGTAAATTTTGTTGAAAATTTAAGCCTCTTAGATACACAAAATGTTGATGAAAAATTTGCAATGAGCAACGATTCCACCTTCTTAAGAGAAGACACTGCTTTTTGTGATACATCTATAAATGAGAGCATACTAAAAAATGCGCCTCTGAGCAGTGATAACTTTTTTGTTGTACCAAAAATTATAGAGTAG |
| Sequence | MQVDDVLLSRLEKLSFLKISEDKREEIVSQLSEIVNFVENLSLLDTQNVDEKFAMSNDSTFLREDTAFCDTSINESILKNAPLSSDNFFVVPKIIE |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | 18065616 |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | Q30R53 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 23
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1318513 | 1318803 | + | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 2 | 1349670 | 1349960 | + | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 3 | 1249544 | 1249834 | + | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 4 | 1167696 | 1167986 | - | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 5 | 565599 | 565889 | - | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 6 | 737038 | 737328 | + | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 7 | 724129 | 724419 | - | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 8 | 752222 | 752512 | - | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 9 | 1234380 | 1234667 | + | NZ_CP063079.1 | Campylobacter peloridis |
| 10 | 195419 | 195712 | - | NZ_CP032823.1 | Aliarcobacter cryaerophilus ATCC 43158 |
| 11 | 519473 | 519760 | + | NZ_CP053826.1 | Campylobacter curvus |
| 12 | 208224 | 208466 | - | NZ_CP032099.1 | Aliarcobacter skirrowii CCUG 10374 |
| 13 | 2095023 | 2095313 | + | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 14 | 547037 | 547324 | + | NZ_CP012544.1 | Campylobacter showae |
| 15 | 2031208 | 2031501 | + | NZ_CP053837.1 | Aliarcobacter faecis |
| 16 | 2007550 | 2007843 | + | NZ_CP054051.1 | Aliarcobacter cibarius |
| 17 | 464059 | 464346 | + | NZ_CP012543.1 | Campylobacter rectus |
| 18 | 662492 | 662782 | - | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 19 | 159553 | 159840 | - | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 20 | 1248380 | 1248667 | - | NZ_CP010995.1 | Campylobacter iguaniorum |
| 21 | 489150 | 489437 | + | NZ_CP053831.1 | Campylobacter mucosalis |
| 22 | 1060510 | 1060791 | - | NC_012115.1 | Nautilia profundicola AmH |
| 23 | 1506665 | 1506949 | + | NZ_CP031611.1 | Campylobacter hepaticus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_013512.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00437.22 | 0.7 | 16 | 23 | same-strand | Type II/IV secretion system protein |
| 2 | PF01475.21 | 0.61 | 14 | 1686.0 | same-strand | Ferric uptake regulator family |
| 3 | PF02674.18 | 0.61 | 14 | 1110.5 | same-strand | Colicin V production protein |
++ More..